KEGG   Thioalkalimicrobium cyclicum: Thicy_0876Help
Entry
Thicy_0876        CDS       T01517                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thicy_0876
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thicy_0876
   00650 Butanoate metabolism
    Thicy_0876
  Energy metabolism
   00190 Oxidative phosphorylation
    Thicy_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1035518..1035850
Genome map
AA seq 110 aa AA seqDB search
MTKIWPNGKWSYLWQQLSATYLLLFFPGFIWLIWPLLMGQSEQPMQPGLLLVSSLIALGL
ILIHSWIGLRDILIDYCPARHLQLALKLYTGIFSLLLLNIISLLLILLLR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatctggccgaatggcaagtggagttatctctggcaacaactcagcgccacg
tatttactgctatttttcccgggctttatttggctaatttggccactgcttatggggcaa
agcgagcaacctatgcaaccaggcctgctgttggtcagcagtcttatcgctttagggctg
attcttattcacagctggattggcttgcgcgatattctgatcgactactgcccggctcgc
catttgcagctggcactcaaactctacactgggatatttagcctactgctgctaaatatc
ataagcctgctgcttattttactacttcgttaa

DBGET integrated database retrieval system