KEGG   Thiomicrospira cyclica: Thicy_0876Help
Entry
Thicy_0876        CDS       T01517                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00020  Citrate cycle (TCA cycle)
tcy00190  Oxidative phosphorylation
tcy00650  Butanoate metabolism
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
tcy01200  Carbon metabolism
Module
tcy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thicy_0876
   00650 Butanoate metabolism
    Thicy_0876
  Energy metabolism
   00190 Oxidative phosphorylation
    Thicy_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEG31648
JGI: Thicy_0876
UniProt: F6DCR2
Position
1035518..1035850
Genome map
AA seq 110 aa AA seqDB search
MTKIWPNGKWSYLWQQLSATYLLLFFPGFIWLIWPLLMGQSEQPMQPGLLLVSSLIALGL
ILIHSWIGLRDILIDYCPARHLQLALKLYTGIFSLLLLNIISLLLILLLR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatctggccgaatggcaagtggagttatctctggcaacaactcagcgccacg
tatttactgctatttttcccgggctttatttggctaatttggccactgcttatggggcaa
agcgagcaacctatgcaaccaggcctgctgttggtcagcagtcttatcgctttagggctg
attcttattcacagctggattggcttgcgcgatattctgatcgactactgcccggctcgc
catttgcagctggcactcaaactctacactgggatatttagcctactgctgctaaatatc
ataagcctgctgcttattttactacttcgttaa

DBGET integrated database retrieval system