KEGG   Thioalkalimicrobium cyclicum: Thicy_1022Help
Entry
Thicy_1022        CDS       T01517                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thicy_1022
Enzymes [BR:tcy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Thicy_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1171914..1172525)
Genome map
AA seq 203 aa AA seqDB search
MIGFLQGTLVSKQPPLLVLDVNGVGYELEAPMSTFYALPDMGVMVKLLTHLHVREDAMLL
YGFAGEAERQLFRELVKVSGIGTKMALAVLSTYSVEDFQHHVHSADTAALAKVPGIGKKT
AERMVIEMRDRMQKVFGQSVTTSYVSADLSANNVNTINKHSAVAALVSLGYKEAQAEGLV
AKVYSDTLSLEQLIKQALLQVRV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgataggctttctgcaaggcactttggtttcaaaacagcctcctttactcgtgttagat
gtaaatggtgtgggttacgagctggaagcacccatgtcaaccttctatgcgttacctgat
atgggtgtcatggttaaactgctaacccatcttcatgtgcgagaggatgccatgttgctt
tatggctttgctggtgaagccgagcgccagttatttcgtgagttagttaaggtgtctgga
atcggcactaagatggctttggctgtgctgtccacctactcggttgaggactttcaacac
catgttcatagcgctgatacagcggccttggctaaggtgcctggcattggtaaaaaaacg
gcagaacgaatggtaattgagatgcgagatcgtatgcaaaaagtgttcggacaaagtgtt
actacaagttacgtttcggcggacttatcggccaataatgttaatactataaacaagcat
tcagcagttgcagccctggtttctttagggtataaagaagcacaagctgagggtttggtc
gcgaaggtttactccgatacgctttcactagagcagttgattaaacaagccttattgcag
gttagggtatga

DBGET integrated database retrieval system