KEGG   Thioalkalimicrobium cyclicum: Thicy_1066Help
Entry
Thicy_1066        CDS       T01517                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Thicy_1066
Enzymes [BR:tcy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Thicy_1066
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Thicy_1066
Lipid biosynthesis proteins [BR:tcy01004]
 Fatty acid synthase
  Component type
   Thicy_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1212322..1212945)
Genome map
AA seq 207 aa AA seqDB search
MIVLGVMAFALVVASQTSQASTTLLVLGDSLSAAYGIPQQDGWVFLLDQKLSQQTMQQLK
NLRVVNASLSGETTSGGLQRLPGLLSQHQPSYVIIELGANDALRGQNLAQTQQNLAQMIE
VSLQQGAKVKLLGIRLPPNYGPAFDRRLAQMYQQLSEQYTVPLDPFFLADVALNPALMLD
DGLHPNAAAQPLILERLWPQLQAWLTE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgattgtattgggtgtgatggcttttgcgttggttgtggccagtcaaacatcacaggcg
tcaacaaccttgctagtgctgggtgatagtttaagcgcggcctatggtattccacaacaa
gacggctgggtgttcttattagaccaaaaactcagtcaacagactatgcaacaattaaaa
aacctacgcgtggtcaatgcgagtctaagcggtgaaaccacctcgggcggtttacagcga
ttaccaggcctgctgtctcagcatcaacccagttatgtcattattgagctgggtgcgaat
gatgctttacgcgggcaaaacttagcgcaaacccagcagaatctcgcacagatgattgaa
gtgagtttacaacagggtgctaaggtgaaattgctgggaatccgcttgccgcccaattat
gggccagcgtttgatcgccgcttagcgcaaatgtatcagcagttatcagaacaatatact
gtgccactggatccgttttttttagcggatgtggcattaaatcccgcgttaatgctggac
gatggattgcacccaaatgccgccgcacaaccacttattcttgagcggttatggccgcag
ttgcaggcttggttaaccgaatga

DBGET integrated database retrieval system