KEGG   Thioalkalimicrobium cyclicum: Thicy_1116Help
Entry
Thicy_1116        CDS       T01517                                 

Definition
Succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thicy_1116
  Amino acid metabolism
   00300 Lysine biosynthesis
    Thicy_1116
Enzymes [BR:tcy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Thicy_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1271906..1273057
Genome map
AA seq 383 aa AA seqDB search
MNSSQTPTIQLAQQLLRIDSVTPDDKGCQTIIADYLAKLDFNNESMPFGEVTNLWSRRGQ
TGPLVVFAGHTDVVPTGPVEKWQYPPFSAEIDGDMLCARGAADMKSAIACFMVATERFVK
DYPNHPGSIGFLITSDEEGPAVNGTVKVIETLAARQEKIDYCLVGEPSSDKKLGDSIKNG
RRGSLNATLTIKGVQGHIAYPQLADNPVHKALPALAALTAIEWDQGNAYFPPTSLQISNV
RAGTGATNVIPGDLQVMFNFRFSTEHTPESLKAGVEACLAPFNLDYEISWNLSGLPFVTP
AEGELIQATSDAIAHCLGYRPTLSTAGGTSDGRFIAPTGAEVIEFGPLNDTIHKLNERVS
LSDLNKLTEVYYHILINLLMKAA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatctcaaacaccgaccatccagttagcgcaacaactgctacgcattgattct
gtgacccctgatgataagggttgtcaaacaatcatcgctgattatttagccaaactcgac
tttaataacgagtcgatgccgtttggcgaagtgaccaacctttggtctcgtcgtggccaa
acaggacctttagttgtgtttgctggtcataccgatgtcgttcccacaggtccagtcgaa
aaatggcaatacccgccctttagtgccgagattgatggcgatatgttgtgcgctcgcggt
gccgctgatatgaaaagtgccattgcttgctttatggtggcaaccgaacgttttgtcaag
gactacccaaaccatcctggctctatcggttttttaattaccagtgatgaagaaggcccc
gctgttaatggcaccgttaaagtgatcgaaaccttggcagcacgccaagaaaaaattgac
tactgcttagtgggcgaaccctcaagtgacaaaaaattgggtgattccattaaaaatggt
cgccgtggttcgcttaatgccaccttaaccattaaaggtgtccaggggcatattgcctat
ccacaactggctgacaacccggtacataaagcgctgcctgcattagccgctttaaccgcc
attgaatgggatcaaggcaatgcctattttccgccgacatcactgcaaatttccaatgtc
cgggccggtaccggtgctactaatgtcatcccgggtgacttgcaggttatgtttaacttt
cgcttctcaaccgaacacactccagagagtttaaaagctggagttgaggcttgcctagcg
cccttcaatttggattatgaaattagctggaatttatcaggtttaccttttgtaacacca
gctgagggcgagctgattcaagcaaccagtgatgcgattgctcattgcttaggttaccga
cccaccctatcaacagcaggcggcacatctgatgggcgatttattgcaccaactggcgcc
gaggttattgaatttggaccacttaatgatacgattcataagctcaatgaacgggtgagc
ttgtcagatcttaataaactaaccgaggtttattatcacattcttattaatttattaatg
aaggcggcgtaa

DBGET integrated database retrieval system