KEGG   Thioalkalimicrobium cyclicum: Thicy_1127Help
Entry
Thicy_1127        CDS       T01517                                 

Definition
succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tcy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tcy00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tcy00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:tcy00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1282203..1283378)
Genome map
AA seq 391 aa AA seqDB search
MNLHEYQAKALFADYDLPVPVGHLIRSLTELAGAYEQLPTDACVVKAQIHAGARGKAGGV
VLASNLAEAEAAATGLLGSHLATHQTAGKALPVDALLIEQTLKIEHEYYLSLLLDRVTKR
YCFVVSPAGGMDIEEVAATQPDQIHRFSVDPVLGVMPYQAREMGFALGLTGVSFKALGHW
FNQLYRMAIERDLMQVEINPLVRIESGELVALDAKVNIDSNALYRQAGLLAQRDMRQEDA
REAEASTHQLNYIALEGNIGCMVNGAGLAMATMDLIQLQGGQPANFLDVGGGTTPARVAA
AFKLILSDPDVKAILVNIFGGIVRCDLIAEGIISAVKEVGLTLPVVVRLEGTNAELGRKM
LAESGLSIEAANDLAQAAARVVELASQGGAQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagcaaaagcattatttgctgactatgatttaccggttccg
gtaggtcatctgattaggtcgctaacggaattagccggtgcttatgaacaattacccaca
gatgcttgtgtggttaaagcgcaaattcatgcgggtgctcgtggtaaagctggtggcgtt
gttttagccagcaatcttgccgaagcggaagcggcggctacaggtctactaggtagtcat
ttagccacccatcaaacagcaggtaaagccttgccggttgatgccctgttgatagaacaa
acgctgaaaattgagcatgaatattacctcagtttgttgctggatcgtgtcaccaaacgc
tattgctttgtggtaagtccggcgggtggtatggacattgaagaggtggcggcaacgcaa
ccagatcaaattcatcgttttagtgttgacccagttctgggtgtcatgccttaccaggct
cgtgaaatgggatttgcgttggggttgactggggtgagttttaaggcactcggtcattgg
tttaatcaattgtatcgaatggcgattgagcgagatctgatgcaggttgaaattaaccct
ttggttcgtatcgaatcgggtgaactggttgcgctggacgccaaagtcaacattgatagt
aacgccttataccgacaagcaggcctgctggcgcaacgtgatatgcgccaagaagacgcg
cgtgaagccgaagcctctacccaccagctcaactatattgcgctcgagggtaatattggt
tgtatggtcaacggtgccggtttagctatggccacgatggatttgattcagttgcaaggt
gggcaacccgctaacttcctagatgtcggcggtggtaccaccccggcacgtgttgcagcg
gcatttaaattaattttgtctgatccggacgtgaaagccatcttagtcaatatttttggc
ggcattgtgcgttgtgacctgattgccgaaggcattattagcgccgtaaaagaggtgggt
ttaaccttgcctgtggtggtgaggctagagggtactaatgcggaattgggtcgtaagatg
ttggctgaaagtggcttgtctatcgaagctgcgaatgatttagcgcaagccgcggcgcgc
gtggttgaattagcatcgcagggaggcgcgcaatga

DBGET integrated database retrieval system