KEGG   Thioalkalimicrobium cyclicum: Thicy_1314Help
Entry
Thicy_1314        CDS       T01517                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thicy_1314
Enzymes [BR:tcy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Thicy_1314
Exosome [BR:tcy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thicy_1314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1493073..1495265)
Genome map
AA seq 730 aa AA seqDB search
MTELNPAIQAGLVKLHEGRLHDPFELLGWHPVADTWQLRVWLPTALEVRIGKQLCEPLGS
QHSGLFALTYSQQQYQQQLKQTAHPMVEWQEADGRSHQGAMPYTFAPLLGELDLHLFAQG
QHWRIYDHLGAHLTEVDGVAGVRFAVWAPAAERVSVVGDFNGWHGLRHPMRCRGSSGLWE
LFIPGLQAQDCYKYEIRNAQTGAVFTKTDPYARAMELRPATASLVEQSHHQWQDQDWLKE
RQQDQWATKPISIYEVHLGSWQKDDQGHFLNYRELAHRLVPYVQWLGFSHIELLPITEHP
FDGSWGYQTSGYYAPTSRFGSPDDFRYFVDYCHQHGIGVYLDWVPAHFPKDSFALARFDG
TALYEHEDPRLGEHRDWGTYIFNYSRNEVRNFLIANALYWLDEFHLDGLRVDAVASMLYL
DYSRNEDEWIPNEYGGRENLAAIAFMQQLNAEVHSQHPGTVVMAEESTSWPMVSRPTWMG
GLGFSMKWNMGWMNDTLDYFAKDPIYRPYHHNQLTFSQVYAYTENFILPISHDEVVHLKG
SLLTKMPGDHWQKFANLRLLLGYQWLQPGKKLLFMGCEFAPWDEWTETQSLPWYLEHQPA
HRGVQLLMKALNELYRQTYALHERDFEQQGFAWLDCHDYEQSVISFERHSAQGSVVVIFN
FTPVLRNHYRIGLSHHGVYREILNSDSNLFGGSNQGNLGQVCSELQPWMDRPASAEIVLP
PLGFIVLQQE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
gtgacagagttaaaccccgcgatacaagcaggcctggttaagttgcatgagggacgtttg
catgatccctttgagttattaggttggcacccagttgctgatacttggcaattgcgggtt
tggttgcctaccgctctggaagttcggataggtaagcagttgtgtgagccgttgggcagt
cagcacagtggcttgtttgcgttgacctattcacaacagcagtatcagcagcagcttaaa
caaacagcacacccaatggttgaatggcaagaagctgatggtcgaagccatcaaggtgcg
atgccctatacctttgccccattactgggcgagttggacttgcatctgtttgcgcaaggc
cagcattggcggatttatgatcatttaggtgcgcatttaaccgaggttgatggtgtagcg
ggcgttcgttttgctgtttgggcaccagcggccgagcgtgtctcggttgtgggtgatttt
aatggctggcatggtttacgtcatccgatgcgttgtcgcggctccagtggtctttgggaa
ttgtttattccgggtctacaggcacaagattgttataaatatgagattcgtaatgcgcaa
acgggcgctgtatttactaaaaccgatccctatgcgcgtgcgatggagttacggccggct
accgcgtctttggttgaacaaagtcatcatcaatggcaggaccaggactggttaaaagaa
cgtcagcaagatcagtgggcgactaaacccattagtatctatgaggtccatttgggatca
tggcaaaaagacgatcaaggccatttcttaaattaccgtgaactcgcccatcgcttagtg
ccttatgtgcaatggctcggttttagccatattgaattgttaccgattaccgagcatcct
tttgatggttcctggggttatcaaacctcaggctattatgcgccgacaagtcgctttggc
agtcccgatgactttcgctattttgtggactattgccatcaacacggcattggggtgtat
ttggattgggtgccagcgcattttccaaaagacagttttgccttggcgcgttttgatggc
actgctctatatgagcacgaggatccacgtttaggtgagcaccgagattggggcacttat
atttttaattacagtcgtaatgaggtgcgtaattttctgattgctaacgcgctttactgg
ttagatgaatttcatcttgatggtttacgagtggatgcggttgcttcgatgctctatttg
gattattcgcgcaatgaagacgagtggattcctaatgagtacggtggtcgcgagaacttg
gccgcaattgcgtttatgcaacaattgaatgcggaagtccattctcagcatccgggcacg
gtggtgatggcggaagaatcgacctcctggccgatggtatcgcgtccgacttggatgggt
ggcttaggcttttcgatgaaatggaatatgggttggatgaatgatactttggattatttt
gccaaagatccgatttatcgaccctatcaccataatcagctgacctttagtcaggtctat
gcctataccgagaactttattttgccgatttctcatgatgaggtggtgcacttaaaaggc
tctttgttaaccaaaatgccaggtgatcattggcaaaagtttgccaatttacgcttgcta
ttaggctatcaatggttacagcccggtaaaaaattgctgtttatgggctgtgagtttgca
ccttgggacgaatggacggaaacccagagtttgccttggtatttagagcatcaaccggcg
catcgtggtgtgcagttgctaatgaaggctttgaatgaactgtatcggcaaacctatgca
ctgcatgaaagagactttgagcagcaaggctttgcctggttagattgccatgattatgag
cagtcggtgattagttttgaacgccatagtgcgcagggtagtgtcgttgtgatatttaat
tttactccggtactgcgtaatcattatcgaattggcttgtcacaccatggtgtttatcgc
gaaatcctaaactccgattccaatttgtttggtggcagtaatcaaggaaatttaggtcag
gtgtgcagtgaactccaaccctggatggatcgtccggcatcggctgagattgtgttaccg
cctttaggctttatcgttttacaacaggaataa

DBGET integrated database retrieval system