KEGG   Thioalkalimicrobium cyclicum: Thicy_1347Help
Entry
Thicy_1347        CDS       T01517                                 

Definition
(RefSeq) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
  KO
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Thicy_1347
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Thicy_1347
Enzymes [BR:tcy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Thicy_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1530377..1531969)
Genome map
AA seq 530 aa AA seqDB search
MSHAMSSERTQPSKTLAVLHEFFGADVTSTHGTWDGSMYVCRLSRQANQCDEQSVFIATA
GLRTHAHTYAVDAVLAGSRLMITDQLPESFPAGLALWLVPNLAARIEALAKWFYDDPSQD
VNLIGITGTNGKTTTSFLTAQALHQLGYRVALMGTLGAGVYPDLVNTGHTTPDIFSIQAW
LASAKQQGCQYAVMEVSSHAVVQGRISGLHFAVKALTQVTEDHLDFHGSLEAYHQAKMNF
FTRYPGSKQACWVLNQQDGVGQRLIKLASAQAANDAVKIAAYAPCHGSSSIQAAMGSLRN
TEVLTLSQQQALSNGYQLQVSWSGYGYSVTSHLLGDHNIENLFCSLRILLALGMNWGDLI
RLVSDLKAPEGRLEQVPCAKPLQVLVDFAHTTDALGKVLTTLNAQRQAAQVKNSIWVVFG
CGGDRDKTKRPAMTAAAYALADKLVLTSDNPRTEAVDGIIADMLTGLPEDYDQSRVMIET
DRKLAITTALNLAQSGDWVLVAGKGHETTQEINGHCYVFSDQQIIKEWLP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgccatgtcgtcggagcgaacacagccgtcaaaaactcttgcagttttgcat
gagttttttggcgctgatgtgacttcaacccatgggacatgggacggctcaatgtacgtt
tgtcgtttatctcgccaggcgaatcagtgcgatgagcaaagtgtgtttattgccacggca
ggcctgcgaactcacgcacatacctatgccgttgatgctgttttggcaggatcgcgttta
atgattacggatcagttgccagaaagttttccagcaggcttagctttatggctcgtgccc
aacttagccgcacgtattgaagccttagctaagtggttttatgacgatcctagtcaagat
gttaatttaattggtattactggcaccaacggtaaaacaacgacgagctttttaacggct
caagccttgcatcagctgggttatcgcgttgcgttaatgggaacgttgggtgccggtgtt
tatcctgatttggtgaacactgggcatacaacaccggatatttttagtatccaggcctgg
ttagcatcagcaaagcaacagggatgccagtatgccgtaatggaagtctcatcgcacgcc
gtggtacagggtcggattagtggattgcactttgctgttaaagccttaacccaggtaacc
gaagaccatttagactttcacggaagtctagaagcttatcatcaagccaaaatgaacttt
tttacccggtatcctggctctaagcaggcctgctgggtattgaatcaacaggatggtgtt
gggcagcgactgatcaaattagcctcagcgcaagcagcaaacgacgcggtgaagatcgcc
gcttatgcgccatgtcatgggtcgagctcaatccaggcggctatgggttcgctgcgcaat
actgaggtgctaacactatcgcagcaacaagccttgagcaacggttatcaacttcaagtc
tcttggagtgggtatggttattcggtgacatcacacctattgggtgaccacaatattgag
aatttgttctgcagtttacgtattttattggcactaggaatgaattggggtgatttgata
aggttggtgtcagatctaaaagcccctgagggtcgattagagcaggtgccttgcgccaag
ccgctgcaagtcttggtcgattttgcccatacaactgatgccctgggtaaagtattaaca
actttgaatgcacagcgccaagccgctcaagttaagaattctatatgggtggtgtttggt
tgtggtggtgaccgtgataaaaccaaacgcccggctatgaccgccgccgcctatgcgctg
gcagataagttggttttaaccagtgataacccgcgcaccgaggcagttgatgggattatt
gccgatatgctcaccggtctacccgaggattatgatcagtctagggtcatgattgaaacg
gatcgaaagttggctattacaacggctttaaacttggcgcagtccggtgattgggtctta
gttgctggcaaaggccatgaaacaacacaagaaattaatgggcattgttatgtcttttct
gatcaacaaattataaaggaatggttaccatga

DBGET integrated database retrieval system