KEGG   Thioalkalimicrobium cyclicum: Thicy_1399Help
Entry
Thicy_1399        CDS       T01517                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tcy  Thioalkalimicrobium cyclicum
Brite
Enzymes [BR:tcy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Thicy_1399
Secretion system [BR:tcy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Thicy_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1584594..1585316)
Genome map
AA seq 240 aa AA seqDB search
MIRSFQTLALAALMGASAMVPAMADKERIQQVLSQMAPGAPAADIQETVVPGLYQVVLGV
TVFYMTADGKHVFNGNLINLEQGVNLTEQRLEQARLDALKAIDPNSMIIFKAKGETKRQV
TVFTDIDCPFCKRFHNQVEKLNEAGIEVRYLAFPRSGPGTPSFAKMESVWCSANPVKAMD
DAKNGLEPEAQRCENPVMSHFQAAQFFNVSGTPTMIIDDGQMVPGFVPAEELIPALLQGN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgattagatcgtttcagacgctggcattagccgcgctaatgggcgccagtgcgatggtt
ccggccatggccgacaaagaacgtattcaacaagtattatcacaaatggcaccgggtgcg
cccgcggcggatatccaagaaaccgtggttccaggtttgtatcaagtggtcttaggcgtc
acggtgttttatatgacggctgatggtaaacatgtgtttaacggtaatttaattaatctt
gagcaaggggtgaatttaaccgaacagcgcttagagcaagcacggttagatgctttgaag
gcgattgatccaaactcgatgattatttttaaagccaaaggtgaaaccaagcgtcaggta
acagtgtttacagatattgattgcccattttgtaagcgctttcataatcaggttgaaaag
ctaaatgaagccggtattgaagtgcgttatttggcgtttccacgttcgggtcctggtaca
ccaagctttgcaaaaatggagtcggtgtggtgtagtgcaaatccggttaaggcgatggat
gatgctaaaaatggcttagagcctgaagcccagcgttgtgaaaatccggtgatgtcgcat
ttccaagcggcacagttctttaatgtatcgggtacgccgacgatgattattgatgatggt
cagatggtgccaggttttgtgcctgctgaagagttgattccggcgttattgcaaggcaac
taa

DBGET integrated database retrieval system