KEGG   Thiomicrospira cyclica: Thicy_1430Help
Entry
Thicy_1430        CDS       T01517                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcy  Thiomicrospira cyclica
Brite
Enzymes [BR:tcy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Thicy_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS CMAS NodS Methyltransf_32 Methyltransf_PK DOT1 Methyltransf_2 MetW Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AEG32190
JGI: Thicy_1430
UniProt: F6DA59
Position
1617089..1617739
Genome map
AA seq 216 aa AA seqDB search
MNFDQARFFMIEQQIRPWDVLDPEILALLESTPRHLYVPESQHKLAYSDLEIPIGEGEFM
LSPKIEAKILQAIDLDPQDRVLEVGTGVGYLTRLISQLAQQVTSVEWYASIAEQAKANLT
SIDNVTVHQGDASQDWPDGESYDAILITGAITSIPKAYYDKLTLGGRLLAFVGQTPAISA
TLVTRISDEEWIEESLFETDVAPLHSLQIRPNSFQF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaccaagcccgtttttttatgattgaacaacaaattcgtccttgggatgtt
ctagatccagaaattcttgcacttctggaatccacacctcgccacctttacgtaccagaa
agccagcataaactggcctacagtgacttagaaattccaatcggcgaaggcgagttcatg
ctcagcccgaaaattgaagcaaaaattttgcaagccattgacctcgatccgcaagaccgc
gttctcgaagtaggcaccggtgttggctatttaacccgcttaatcagccaactagctcaa
caggttaccagcgtcgaatggtacgccagtattgcagaacaagccaaggcgaacttgacc
agtattgacaatgtaaccgtgcaccagggtgatgctagccaagattggcctgacggggaa
agctacgatgccatattaatcaccggggcaattacaagtatccccaaagcctattatgac
aaactaacactcggtggccgtctattggcctttgttggtcaaactccagctatctcagct
acactggtaacccgtatcagtgatgaagaatggattgaagagtctttatttgaaacagac
gtagcccccttgcacagtctacaaatacgcccgaatagcttccaattctaa

DBGET integrated database retrieval system