KEGG   Thioalkalimicrobium cyclicum: Thicy_1434Help
Entry
Thicy_1434        CDS       T01517                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tcy  Thioalkalimicrobium cyclicum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Thicy_1434
   00240 Pyrimidine metabolism
    Thicy_1434
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Thicy_1434
   03430 Mismatch repair
    Thicy_1434
   03440 Homologous recombination
    Thicy_1434
Enzymes [BR:tcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Thicy_1434
DNA replication proteins [BR:tcy03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Thicy_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1621723..1622160
Genome map
AA seq 145 aa AA seqDB search
MNTAVEPNLVFYVLETADAQSRELFLAKLLLKIQQQRRRADVRFETLDQAERFDHIAWQL
PPDRYLGHSLAGHFPSHIQLHGPELIKPQGDVLINLHPEPYTELSGFQRTIEVLDQSPER
IEPGRERWRQYKQQGLTPVVHKING
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcagttgagccaaatttagtcttttatgtattagaaacggccgatgcgcag
agtcgggagttgtttcttgccaagttgttgttgaaaatacagcaacaacgacggcgcgcc
gatgtgcgttttgaaacgcttgatcaagcggagcgctttgaccatattgcttggcagtta
ccgcctgatcgctatctcggtcatagcttggctggtcattttccgagccacattcaattg
catggtccagagctgatcaaacctcaaggtgatgtgttaattaatcttcaccctgagccc
tatacggagttaagtggttttcaacgcaccatagaagtattagatcagtcaccagaacgg
attgaaccgggtcgcgagcgctggcgtcaatacaaacagcaaggactcacacccgttgtg
cataagattaacggctga

DBGET integrated database retrieval system