KEGG   Treponema denticola: TDE0040Help
Entry
TDE0040           CDS       T00157                                 

Definition
(RefSeq) AMP-binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tde  Treponema denticola
Pathway
tde00010  Glycolysis / Gluconeogenesis
tde00620  Pyruvate metabolism
tde00640  Propanoate metabolism
tde00680  Methane metabolism
tde01100  Metabolic pathways
tde01110  Biosynthesis of secondary metabolites
tde01120  Microbial metabolism in diverse environments
tde01130  Biosynthesis of antibiotics
tde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDE0040
   00620 Pyruvate metabolism
    TDE0040
   00640 Propanoate metabolism
    TDE0040
  Energy metabolism
   00680 Methane metabolism
    TDE0040
Enzymes [BR:tde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TDE0040
Lipid biosynthesis proteins [BR:tde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TDE0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 2741655
NCBI-ProteinID: NP_970657
UniProt: Q73RP5
Position
complement(45866..47518)
Genome map
AA seq 550 aa AA seqDB search
MFYKEYINYIESDDWETVHNSFSVKAPENFNFAYDIIDRMAKEYPEKEALVWCDETEERI
FSFGELAKQINKTANFFKAMGIGRGDTVLLFLRRRYEFWFVLPALHKIGAIAVPATVQLA
AHDIEYRIQSANIKMIMAVQEKNLQEEIQKAAESAYNKPLLVWVHDEMEGWISFDELVKN
MSEDFTPPQGNSYPCGKDIALLYFTSGTSGNPKMVEHNFLYPLGHIATAKFWQNVKEGGR
HLSVAETGWAKAMWGKIYGQWLCGCAVFVYDMKMFIPKNLLEKLSKYRVTSFCAPPTVYR
YLIREKIEDYDLSSLEECTTAGEALSMDIFNTFKEKTGIELREGYGQTELTLTTGTFPGM
KIKPGSMGKPAPGYEIDIIRPDGSSCKAGESGEIILRLDKKVPFGMFGGYYKNEEKTAEV
FKDGVYHTGDAAYRDEDGYFWFESRTDDLIKSSGFRISPFEVESVLLQHPAVFECAVTGV
PDPKRGQAVKAFVVLNKTYQPSQALEKELMFFAKKNAALYKAPRSLEFVETLPKTHNGKI
SRAAIRSRKV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgttttataaagaatatataaactatattgaaagcgatgattgggaaaccgtacataat
tctttttcagttaaagctcccgagaattttaattttgcttatgacataatagatagaatg
gctaaggaataccccgaaaaagaggctctcgtatggtgcgatgaaaccgaagaaaggatt
ttttcgttcggagaattggcaaagcagataaataaaacagccaacttttttaaggccatg
ggaataggaagaggcgacacggttttgctttttttgcgaagaagatacgagttttggttt
gttcttcctgccctgcacaaaataggggcaatagccgttcctgcaacggtccagctcgca
gctcacgacatcgaataccgtattcaatccgccaatataaaaatgataatggccgtacaa
gaaaagaatttgcaagaagaaattcaaaaagctgctgagtccgcttataataagcccctt
cttgtctgggtgcatgacgaaatggagggttggatttcctttgatgaactcgtaaaaaat
atgagtgaagattttacacctccccaagggaattcctacccttgcggaaaggacatagct
cttttgtactttacctcaggtacttcgggcaatcccaaaatggtggagcataatttttta
tatcctcttggacacattgcgactgcaaaattttggcaaaatgtcaaggaaggcggaaga
cacttaagcgttgcagaaacaggctgggcaaaggctatgtggggaaagatttacggtcaa
tggctctgcggctgtgccgtctttgtgtacgacatgaaaatgtttatccctaaaaacctg
ctcgaaaaattatcaaaatacagggtaacttccttttgtgcacctcctaccgtttacagg
tacttaatccgcgaaaaaatagaagattacgatttatcctcattggaagaatgtacaacg
gcaggtgaagcccttagcatggacatattcaatacatttaaagaaaagactggaatagaa
ctgcgggaaggctacgggcaaacagagcttaccctcacaacaggaaccttccccggcatg
aaaattaaacccggctcgatgggaaagcccgcccccggctatgagatagatattatccgc
cccgacggatcttcttgcaaggcaggagaatcgggagaaatcatcttgcgtttggataaa
aaggttcctttcggaatgttcgggggttattataaaaatgaagaaaaaacggccgaggtt
tttaaggacggagtttaccacacgggagacgccgcctatagggatgaagacggttatttt
tggtttgaaagccgaaccgatgaccttataaaaagctccggtttccgtataagccccttt
gaggtggagtcggttcttctccagcatccggcagtctttgaatgtgcggtaacaggcgta
cccgaccctaagagaggtcaggcggtaaaggcctttgttgttttgaacaaaacctatcag
ccgagccaagccttggaaaaagagcttatgttctttgcaaagaaaaatgcggccctttac
aaggccccgcgttctctcgaatttgtagaaactttgccgaaaacccataacggcaagata
agccgggctgcaatcagaagccgaaaggtctga

DBGET integrated database retrieval system