KEGG   Treponema denticola: TDE0040Help
Entry
TDE0040           CDS       T00157                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tde  Treponema denticola
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDE0040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDE0040
   00620 Pyruvate metabolism
    TDE0040
   00640 Propanoate metabolism
    TDE0040
  Energy metabolism
   00680 Methane metabolism
    TDE0040
Enzymes [BR:tde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TDE0040
Lipid biosynthesis proteins [BR:tde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TDE0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(45866..47518)
Genome map
AA seq 550 aa AA seqDB search
MFYKEYINYIESDDWETVHNSFSVKAPENFNFAYDIIDRMAKEYPEKEALVWCDETEERI
FSFGELAKQINKTANFFKAMGIGRGDTVLLFLRRRYEFWFVLPALHKIGAIAVPATVQLA
AHDIEYRIQSANIKMIMAVQEKNLQEEIQKAAESAYNKPLLVWVHDEMEGWISFDELVKN
MSEDFTPPQGNSYPCGKDIALLYFTSGTSGNPKMVEHNFLYPLGHIATAKFWQNVKEGGR
HLSVAETGWAKAMWGKIYGQWLCGCAVFVYDMKMFIPKNLLEKLSKYRVTSFCAPPTVYR
YLIREKIEDYDLSSLEECTTAGEALSMDIFNTFKEKTGIELREGYGQTELTLTTGTFPGM
KIKPGSMGKPAPGYEIDIIRPDGSSCKAGESGEIILRLDKKVPFGMFGGYYKNEEKTAEV
FKDGVYHTGDAAYRDEDGYFWFESRTDDLIKSSGFRISPFEVESVLLQHPAVFECAVTGV
PDPKRGQAVKAFVVLNKTYQPSQALEKELMFFAKKNAALYKAPRSLEFVETLPKTHNGKI
SRAAIRSRKV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgttttataaagaatatataaactatattgaaagcgatgattgggaaaccgtacataat
tctttttcagttaaagctcccgagaattttaattttgcttatgacataatagatagaatg
gctaaggaataccccgaaaaagaggctctcgtatggtgcgatgaaaccgaagaaaggatt
ttttcgttcggagaattggcaaagcagataaataaaacagccaacttttttaaggccatg
ggaataggaagaggcgacacggttttgctttttttgcgaagaagatacgagttttggttt
gttcttcctgccctgcacaaaataggggcaatagccgttcctgcaacggtccagctcgca
gctcacgacatcgaataccgtattcaatccgccaatataaaaatgataatggccgtacaa
gaaaagaatttgcaagaagaaattcaaaaagctgctgagtccgcttataataagcccctt
cttgtctgggtgcatgacgaaatggagggttggatttcctttgatgaactcgtaaaaaat
atgagtgaagattttacacctccccaagggaattcctacccttgcggaaaggacatagct
cttttgtactttacctcaggtacttcgggcaatcccaaaatggtggagcataatttttta
tatcctcttggacacattgcgactgcaaaattttggcaaaatgtcaaggaaggcggaaga
cacttaagcgttgcagaaacaggctgggcaaaggctatgtggggaaagatttacggtcaa
tggctctgcggctgtgccgtctttgtgtacgacatgaaaatgtttatccctaaaaacctg
ctcgaaaaattatcaaaatacagggtaacttccttttgtgcacctcctaccgtttacagg
tacttaatccgcgaaaaaatagaagattacgatttatcctcattggaagaatgtacaacg
gcaggtgaagcccttagcatggacatattcaatacatttaaagaaaagactggaatagaa
ctgcgggaaggctacgggcaaacagagcttaccctcacaacaggaaccttccccggcatg
aaaattaaacccggctcgatgggaaagcccgcccccggctatgagatagatattatccgc
cccgacggatcttcttgcaaggcaggagaatcgggagaaatcatcttgcgtttggataaa
aaggttcctttcggaatgttcgggggttattataaaaatgaagaaaaaacggccgaggtt
tttaaggacggagtttaccacacgggagacgccgcctatagggatgaagacggttatttt
tggtttgaaagccgaaccgatgaccttataaaaagctccggtttccgtataagccccttt
gaggtggagtcggttcttctccagcatccggcagtctttgaatgtgcggtaacaggcgta
cccgaccctaagagaggtcaggcggtaaaggcctttgttgttttgaacaaaacctatcag
ccgagccaagccttggaaaaagagcttatgttctttgcaaagaaaaatgcggccctttac
aaggccccgcgttctctcgaatttgtagaaactttgccgaaaacccataacggcaagata
agccgggctgcaatcagaagccgaaaggtctga

DBGET integrated database retrieval system