KEGG   Treponema denticola: TDE0064Help
Entry
TDE0064           CDS       T00157                                 

Gene name
pfk
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tde  Treponema denticola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDE0064 (pfk)
   01230 Biosynthesis of amino acids
    TDE0064 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDE0064 (pfk)
   00030 Pentose phosphate pathway
    TDE0064 (pfk)
   00051 Fructose and mannose metabolism
    TDE0064 (pfk)
   00052 Galactose metabolism
    TDE0064 (pfk)
  Energy metabolism
   00680 Methane metabolism
    TDE0064 (pfk)
Enzymes [BR:tde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TDE0064 (pfk)
Protein phosphatases and associated proteins [BR:tde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TDE0064 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71425..72741)
Genome map
AA seq 438 aa AA seqDB search
MKKTDFSISTLGECKIQSPIMLSETHGDLIANYVTDNEFIRYNLDASLGETGEPLTHADI
IEKAGPRQKIYFSPNYVHAAIATCGGLCPGINDVIRAIVRCLWTRYGVRRISGIKFGYKG
FISEYGFSPVPLTPEAVNGIHKTGGSFLGTSRGGGTRVTEIVDGIEQMNINMVFFIGGDG
TQKGALEVSREIERRKLKISVIGIPKTIDNDLSFIQKSFGFDTAIAKATESVAAANMEAS
SQINGIGLVKLMGRESGFIATHTAIACHEAHFVLIPEVRFELGGENGFLKLLEKKLIENG
YALIVAAEGAGQHLMNIEEETDASGNKKLADIGLFLKKEITEYFDKIGMHINLKYIDPSY
QIRSSIAAPIDSVYCERLGNNAVHAAMAGKTRTLIGLVNNKFVHLPIEQVVSERKYVNPE
SSLWRDALDATGQPTTMI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacggacttttccatttctacattgggagaatgtaaaatacagtctcctatt
atgctgtcggaaacacacggagatctgattgcaaactatgttaccgataacgaatttata
agatataatttggatgcctccttgggtgaaacaggagagcctttaactcacgccgacatt
atcgaaaaggccgggcctcgtcaaaagatctactttagccccaactatgtacatgctgca
attgctacctgcggaggtttatgccccggtataaatgatgttataagggctatagtacgc
tgtctgtggacaaggtacggagtccgccgaatcagcggtataaaattcggatataaggga
tttatttccgaatatgggttttctcccgttccattgactcctgaagcagtaaacggaatc
cataaaacgggaggttcttttttgggcacttcccgaggcggaggtacaagggtcaccgaa
atagtagacggaatcgagcagatgaatatcaatatggtattttttatcggcggtgacggt
acgcaaaaaggagctctcgaagtttcaagagaaattgaaaggcgtaaattaaaaatttcg
gtaataggtattcccaaaactatagataatgatctttcttttatacaaaagtctttcgga
ttcgatacggctattgcaaaggctaccgaatctgttgcagcggccaatatggaggccagt
tctcaaatcaacggtataggcttggtaaagcttatgggaagggagtcgggctttatcgca
acccatacggctattgcctgtcatgaggcgcactttgttcttatacccgaagtccgcttt
gaattgggcggtgaaaacggctttttaaagcttttggaaaaaaagcttattgaaaatggt
tatgccctcattgttgcagccgaaggcgccggtcagcatttaatgaatattgaagaagaa
acggatgcttcaggaaacaaaaaacttgcggatataggtttgtttttgaaaaaagaaata
accgagtattttgataagatcgggatgcatataaacttaaaatacattgatcccagttat
cagattagatcttcaattgcagctcccatcgattcggtttattgcgaacgcttaggcaac
aatgcggttcatgctgctatggcagggaagacccgcacccttatagggcttgtaaacaat
aaatttgtgcacctgccgattgaacaagttgtctcggaaagaaaatatgttaaccctgaa
agttctttgtggcgtgatgcactggatgctacaggccagcccacgacaatgatatag

DBGET integrated database retrieval system