KEGG   Treponema denticola: TDE0064Help
Entry
TDE0064           CDS       T00157                                 

Gene name
pfk
Definition
(RefSeq) diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tde  Treponema denticola
Pathway
tde00010  Glycolysis / Gluconeogenesis
tde00030  Pentose phosphate pathway
tde00051  Fructose and mannose metabolism
tde00052  Galactose metabolism
tde00680  Methane metabolism
tde01100  Metabolic pathways
tde01110  Biosynthesis of secondary metabolites
tde01120  Microbial metabolism in diverse environments
tde01130  Biosynthesis of antibiotics
tde01200  Carbon metabolism
tde01230  Biosynthesis of amino acids
tde03018  RNA degradation
Module
tde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDE0064 (pfk)
   00030 Pentose phosphate pathway
    TDE0064 (pfk)
   00051 Fructose and mannose metabolism
    TDE0064 (pfk)
   00052 Galactose metabolism
    TDE0064 (pfk)
  Energy metabolism
   00680 Methane metabolism
    TDE0064 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TDE0064 (pfk)
Enzymes [BR:tde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TDE0064 (pfk)
Protein phosphatases and associated proteins [BR:tde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TDE0064 (pfk)
Messenger RNA biogenesis [BR:tde03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TDE0064 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 2741679
NCBI-ProteinID: NP_970681
UniProt: Q73RM4
Position
complement(71425..72741)
Genome map
AA seq 438 aa AA seqDB search
MKKTDFSISTLGECKIQSPIMLSETHGDLIANYVTDNEFIRYNLDASLGETGEPLTHADI
IEKAGPRQKIYFSPNYVHAAIATCGGLCPGINDVIRAIVRCLWTRYGVRRISGIKFGYKG
FISEYGFSPVPLTPEAVNGIHKTGGSFLGTSRGGGTRVTEIVDGIEQMNINMVFFIGGDG
TQKGALEVSREIERRKLKISVIGIPKTIDNDLSFIQKSFGFDTAIAKATESVAAANMEAS
SQINGIGLVKLMGRESGFIATHTAIACHEAHFVLIPEVRFELGGENGFLKLLEKKLIENG
YALIVAAEGAGQHLMNIEEETDASGNKKLADIGLFLKKEITEYFDKIGMHINLKYIDPSY
QIRSSIAAPIDSVYCERLGNNAVHAAMAGKTRTLIGLVNNKFVHLPIEQVVSERKYVNPE
SSLWRDALDATGQPTTMI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacggacttttccatttctacattgggagaatgtaaaatacagtctcctatt
atgctgtcggaaacacacggagatctgattgcaaactatgttaccgataacgaatttata
agatataatttggatgcctccttgggtgaaacaggagagcctttaactcacgccgacatt
atcgaaaaggccgggcctcgtcaaaagatctactttagccccaactatgtacatgctgca
attgctacctgcggaggtttatgccccggtataaatgatgttataagggctatagtacgc
tgtctgtggacaaggtacggagtccgccgaatcagcggtataaaattcggatataaggga
tttatttccgaatatgggttttctcccgttccattgactcctgaagcagtaaacggaatc
cataaaacgggaggttcttttttgggcacttcccgaggcggaggtacaagggtcaccgaa
atagtagacggaatcgagcagatgaatatcaatatggtattttttatcggcggtgacggt
acgcaaaaaggagctctcgaagtttcaagagaaattgaaaggcgtaaattaaaaatttcg
gtaataggtattcccaaaactatagataatgatctttcttttatacaaaagtctttcgga
ttcgatacggctattgcaaaggctaccgaatctgttgcagcggccaatatggaggccagt
tctcaaatcaacggtataggcttggtaaagcttatgggaagggagtcgggctttatcgca
acccatacggctattgcctgtcatgaggcgcactttgttcttatacccgaagtccgcttt
gaattgggcggtgaaaacggctttttaaagcttttggaaaaaaagcttattgaaaatggt
tatgccctcattgttgcagccgaaggcgccggtcagcatttaatgaatattgaagaagaa
acggatgcttcaggaaacaaaaaacttgcggatataggtttgtttttgaaaaaagaaata
accgagtattttgataagatcgggatgcatataaacttaaaatacattgatcccagttat
cagattagatcttcaattgcagctcccatcgattcggtttattgcgaacgcttaggcaac
aatgcggttcatgctgctatggcagggaagacccgcacccttatagggcttgtaaacaat
aaatttgtgcacctgccgattgaacaagttgtctcggaaagaaaatatgttaaccctgaa
agttctttgtggcgtgatgcactggatgctacaggccagcccacgacaatgatatag

DBGET integrated database retrieval system