KEGG   Treponema denticola: TDE0068Help
Entry
TDE0068           CDS       T00157                                 

Definition
(RefSeq) diaminopimelate aminotransferase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tde  Treponema denticola
Pathway
tde00300  Lysine biosynthesis
tde01100  Metabolic pathways
tde01120  Microbial metabolism in diverse environments
tde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TDE0068
Enzymes [BR:tde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TDE0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 2741683
NCBI-ProteinID: NP_970685
UniProt: Q73RM0
Position
75437..76672
Genome map
AA seq 411 aa AA seqDB search
MSTFKKITDFIESKTNDIIGLERLLTSIPAMAPESDGDGELKKCEALEKYLKEAGFSNFE
RLDAPDERVSSKIRPNLIVTIPGKNDKERLWIMSHLDVVPPGDLSKWESDPWTVIEKDGK
LIGRGVEDNQQGLVSSVFAALAFIKLGITPEHTIKLLFVADEEVGSQYGIIYLLNKHNLF
TNDDLILVPDGGDPKGETIEIAEKTGLWLKVITKGVQTHASMPNTGKNAFVAACDLALRL
NDLENHFNKKDDLFSPNYSTFQPTKKEANVPNVNTIPGDDVFYVDCRILPSYDVNEVLKE
MQKRASEVEKKYGVGIRFEYDEPEASPATPKDAKIVSLLSSAVKKVKGIETSTIGIGGGT
VAACLRSKGFNAVVWSSLDDSCHQPNEYAFIKNIISDAKVMAAMMFGVENI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctttaaaaaaattaccgattttattgaatccaaaacaaacgatattatagga
ttggaaaggcttttaacttccattcctgccatggctccggaatccgatggagacggagaa
ttaaaaaaatgtgaagccctggaaaaatatttaaaagaagcgggttttagcaattttgaa
cgcttagatgccccagatgagagggtttcttcaaaaatacgccctaatctgattgtcacc
attcccggaaaaaacgataaggaaaggctctggattatgagccatctggatgtagttccg
cccggagacctgtctaagtgggaaagcgatccttggactgtaatcgaaaaggacggaaaa
cttataggccgcggagttgaagacaaccagcagggccttgtttcttcggtttttgcagcc
ttggcttttatcaaattaggaatcacccccgaacatactatcaagcttttatttgtggcc
gatgaagaagtcggctcccaatacggcataatttacctcctcaataagcacaatcttttt
acaaacgatgatttgattcttgtaccagatggaggcgaccctaagggagaaacgatagaa
atagccgaaaaaaccggcctttggctaaaggttattacgaagggcgtccaaacccatgct
tcaatgcctaacacgggcaaaaacgcctttgttgcagcctgcgaccttgccctccgctta
aacgacttagaaaatcattttaacaaaaaagacgatttattttcgcctaattattcaacc
tttcagccgactaaaaaagaagccaatgtaccgaatgtaaacacaattccgggagacgat
gttttttatgtagactgccgaattcttccttcttacgatgtaaacgaagtcctaaaagaa
atgcaaaaaagagcttcagaggttgaaaaaaagtatggagtgggtatcagatttgaatat
gatgaacctgaggcctctcctgcaacacctaaggatgcgaagattgtaagccttctttca
tctgccgtaaaaaaggtaaaaggaattgaaacctctacgataggaataggaggcggaacg
gtcgctgcctgtctgcgctctaagggctttaatgccgttgtttggagctcccttgatgac
agctgccaccagcccaacgaatatgcttttataaagaatatcataagcgatgcaaaggtt
atggcagctatgatgttcggtgtcgaaaatatttaa

DBGET integrated database retrieval system