KEGG   Treponema denticola: TDE0187Help
Entry
TDE0187           CDS       T00157                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tde  Treponema denticola
Brite
Enzymes [BR:tde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TDE0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
223985..224752
Genome map
AA seq 255 aa AA seqDB search
MFFDNYPIKLSDTTKPFFLKGLKTAPAILLIHGYTGSPRDMIWLGHQLNEAGYNIYIPRL
PGHGTNKNDFLTTNWKDWLRKVCDEYIDLCAMYERVFVGGLSMGGVLTSLIAARFNPEKI
FLCAPAFIAADNRIKLTPFLKFFVKKIATVKKTYENDPEYGRAISDYNGVEYLAKTADLY
KLQRLALKNMVFIRSQSLTVLSKADKLVPFKVKDLIDKTLRNQNDYLILEKSSHIVTNDV
EKELVAKKIIEFLKD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgttttttgacaattatcctatcaaactttcagatacaacaaaacccttttttttaaaa
ggcctgaaaaccgctccggctattttgctgattcatggttacacgggttctcccagagat
atgatttggctggggcatcagctaaatgaagccggctacaatatatatattcctcggctt
cccggacacggcacaaataagaatgattttttgactactaattggaaagattggctccgt
aaggtttgtgatgagtatattgacctctgtgcaatgtatgaacgagtttttgtaggaggc
ctttcaatgggaggggtattaacctctctgattgcagcccgttttaaccctgaaaagata
tttttatgtgctccggcttttatagcagcggataatcgaataaaacttactcctttttta
aagttttttgtcaaaaagatagcaaccgtcaaaaaaacttatgaaaatgaccccgaatac
ggcagagccatatcggactataacggtgtagaatacttagcaaaaacggctgacctttat
aaattacaaagattagccttaaaaaatatggtttttataagatcgcaaagccttacagtc
ttatcaaaagccgataaattggtgccctttaaggtaaaagacctcatagataagacttta
agaaatcaaaacgactatctaatccttgaaaaaagcagtcacatagttacaaatgatgtt
gaaaaagagcttgtagcaaaaaaaataatagaattcttaaaggattaa

DBGET integrated database retrieval system