KEGG   Treponema denticola: TDE0648Help
Entry
TDE0648           CDS       T00157                                 

Gene name
cheB
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tde  Treponema denticola
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TDE0648 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TDE0648 (cheB)
Enzymes [BR:tde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TDE0648 (cheB)
Two-component system [BR:tde02022]
 CheA family
  CheA-CheYBV
   TDE0648 (cheB)
Bacterial motility proteins [BR:tde02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TDE0648 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
682940..684058
Genome map
AA seq 372 aa AA seqDB search
MEDIRVLIVDDSALMRNLIGKIVDATPGLKIADKAMNGRFALQKLERVAPDVIVLDLEMP
EMNGIEFLRELKKQNIKIPVVILSSIAKEGAKVTMDCLELGACDFITKPSGSESANLTTV
SETLSKMLLAYGRRHQIETGTRSTDTTNSFSEPFKSTIPKPMTAAEPQKEEKPTPQREHG
NIQIIAIGISTGGPNALRQVFASIDKDLPQPIVVVQHMPPGFTKEFALSLDKICPLEVKE
AEDGDLIKPGRILIAPGGKHLVVEKRSLAAVAKVIDTEPQSGHKPSVDVLFGSVAKEYQN
HALGIIMTGMGKDGAENITKLYTEGSRTIGQDEGSSVVYGMPRVAWEMGGVMEQVSLDNM
AAAINRYGKEFA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaagatattcgtgtcttaatagtagacgattctgcattgatgagaaaccttataggg
aagattgttgatgctactcccggcctaaaaatagccgataaggcaatgaacggccgcttt
gcccttcaaaaacttgagcgtgtggctccggatgttatcgttttggacttggaaatgccc
gaaatgaacggtatcgaatttttaagagagcttaaaaagcaaaacataaagattcctgta
gtaatcttgtccagtattgcaaaggaaggagctaaggttactatggattgtttggaactt
ggagcttgcgattttatcacaaagccttccggttcggaatctgccaatcttactaccgtt
tcggaaactctttccaagatgctgcttgcctacggccgccgtcatcaaattgagacaggt
acaagaagtacagatacaacgaactctttctctgagccgtttaagagtactatccctaag
cctatgacagcggctgagcctcaaaaagaagagaaacctacacctcaacgagaacatgga
aatattcagattattgctataggtatttcaaccggcgggccgaatgctttacgccaagtt
tttgcatccatcgataaagatcttccacaaccgatagttgtggttcagcacatgcccccg
ggttttacaaaggaatttgctttgagtttggacaaaatctgccctcttgaggtaaaggaa
gctgaagacggcgatcttataaagcccggccgtattcttatcgctcccggcggaaaacat
ctggttgtagaaaaacgatctcttgccgcagttgcaaaggttatagatacggagcctcaa
agcggccataagcccagcgttgatgttctgtttggatctgttgcaaaggaataccaaaac
catgctctcggaataatcatgaccggtatggggaaggatggtgccgagaatattacaaag
ctttacaccgaaggttcccgtacaatagggcaagatgaaggctcttcagttgtatacggt
atgcctagggttgcatgggaaatgggcggagttatggagcaggtaagtcttgataatatg
gctgctgctataaaccgttacggtaaagaatttgcttaa

DBGET integrated database retrieval system