KEGG   Treponema denticola: TDE0751Help
Entry
TDE0751           CDS       T00157                                 

Definition
magnesium chelatase subunit D/I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tde  Treponema denticola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TDE0751
Enzymes [BR:tde01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TDE0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(790212..791141)
Genome map
AA seq 309 aa AA seqDB search
MTEKQIFPFVQIEGQEDIKLAIILNLICPAISGVLIRGEKGTGKSTIVRGIGELMQRQGE
NLKVIELPINATEDRVAGSIDIERVLKTGEKVLQKGILAEADGNILYADEINLLEDYIVD
LLLDAAAMGVNTIERDGISYSHSSKFILIGTMNPEEGELRPQLLDRFGLLVDVKSEKDGH
LRKEIIKKRLAFENDPVEFINASHKEEKKLISKIKKAQKRLPLIKTTDEILDLVVSLSIG
LNVDGHRGDLTLVRAAKAYAAFQERDEVTKDDIIRLAQMVYSHRLRKKPFEEINPLNQAD
IENILNERL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaacagatttttccatttgtacaaattgaaggacaggaagatataaagctt
gcaataattttaaatttaatatgtcctgcaatttcgggtgttctaatccgtggagaaaaa
ggaacaggaaagtctacaattgtgagaggaataggggagctgatgcaaagacagggagaa
aaccttaaagttatagagcttcctataaatgctactgaagacagagtcgccggctcaatc
gatattgaaagagttttaaaaacaggcgaaaaagttcttcaaaaaggaatcttagcagaa
gctgacggtaatattttgtatgcggatgagataaatctcttggaagattatatagtcgac
ctcttattggatgcggccgccatgggagtaaacacaatagaaagagacggaatatcatac
agccactcatccaaatttatcctgataggaacaatgaatcctgaagaaggggaactaagg
cctcagcttttagatcgattcggtttattggtcgatgtaaaaagtgaaaaggatggacac
ttaaggaaagaaattataaaaaaaagacttgcttttgaaaatgatcctgtggaatttata
aacgcctctcataaagaagaaaaaaaattaatatcaaaaataaaaaaagctcaaaaacgc
cttcctcttattaagacaacggatgagattttagatttagttgtaagcctttctataggc
ttaaatgtggacggccacaggggagacctaaccttagttagagccgccaaggcctatgca
gcctttcaagaaagagatgaggttacaaaagacgatattatccgtttagcacaaatggta
tattctcataggcttaggaaaaagccctttgaagaaataaatccattaaaccaagcagat
attgagaacatcttaaatgaaaggctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system