KEGG   Treponema denticola: TDE0751Help
Entry
TDE0751           CDS       T00157                                 

Definition
(RefSeq) magnesium chelatase subunit D/I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tde  Treponema denticola
Pathway
tde00860  Porphyrin and chlorophyll metabolism
tde01100  Metabolic pathways
tde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TDE0751
Enzymes [BR:tde01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TDE0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Sigma54_activat MCM Mg_chelatase DUF815 AAA AAA_3 AAA_16 ABC_tran AAA_30 ATP_bind_1 AAA_29 AAA_18 RNA_pol_Rpb5_C NACHT
Motif
Other DBs
NCBI-GeneID: 2739870
NCBI-ProteinID: NP_971362
UniProt: Q73PP6
Position
complement(790212..791141)
Genome map
AA seq 309 aa AA seqDB search
MTEKQIFPFVQIEGQEDIKLAIILNLICPAISGVLIRGEKGTGKSTIVRGIGELMQRQGE
NLKVIELPINATEDRVAGSIDIERVLKTGEKVLQKGILAEADGNILYADEINLLEDYIVD
LLLDAAAMGVNTIERDGISYSHSSKFILIGTMNPEEGELRPQLLDRFGLLVDVKSEKDGH
LRKEIIKKRLAFENDPVEFINASHKEEKKLISKIKKAQKRLPLIKTTDEILDLVVSLSIG
LNVDGHRGDLTLVRAAKAYAAFQERDEVTKDDIIRLAQMVYSHRLRKKPFEEINPLNQAD
IENILNERL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaacagatttttccatttgtacaaattgaaggacaggaagatataaagctt
gcaataattttaaatttaatatgtcctgcaatttcgggtgttctaatccgtggagaaaaa
ggaacaggaaagtctacaattgtgagaggaataggggagctgatgcaaagacagggagaa
aaccttaaagttatagagcttcctataaatgctactgaagacagagtcgccggctcaatc
gatattgaaagagttttaaaaacaggcgaaaaagttcttcaaaaaggaatcttagcagaa
gctgacggtaatattttgtatgcggatgagataaatctcttggaagattatatagtcgac
ctcttattggatgcggccgccatgggagtaaacacaatagaaagagacggaatatcatac
agccactcatccaaatttatcctgataggaacaatgaatcctgaagaaggggaactaagg
cctcagcttttagatcgattcggtttattggtcgatgtaaaaagtgaaaaggatggacac
ttaaggaaagaaattataaaaaaaagacttgcttttgaaaatgatcctgtggaatttata
aacgcctctcataaagaagaaaaaaaattaatatcaaaaataaaaaaagctcaaaaacgc
cttcctcttattaagacaacggatgagattttagatttagttgtaagcctttctataggc
ttaaatgtggacggccacaggggagacctaaccttagttagagccgccaaggcctatgca
gcctttcaagaaagagatgaggttacaaaagacgatattatccgtttagcacaaatggta
tattctcataggcttaggaaaaagccctttgaagaaataaatccattaaaccaagcagat
attgagaacatcttaaatgaaaggctttga

DBGET integrated database retrieval system