KEGG   Treponema denticola: TDE0825Help
Entry
TDE0825           CDS       T00157                                 

Definition
(RefSeq) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tde  Treponema denticola
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TDE0825
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TDE0825
Enzymes [BR:tde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TDE0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846102..847700
Genome map
AA seq 532 aa AA seqDB search
MEYTKSIAECIKAIEVVNCFGNDKSLINSVEYDSRKVRAYSYDDKTGLKKGAAFFALPGI
HTDGKKFINSAIENGAVCIFYEGDLNNHSCDEICFVQVNDVRKTMSKVSALLYDEPSRTL
GVIGVTGTEGKSSTVSFIFQLLNLCGKKAGFFSTVEYSIDGNVIPNPEHQTTPESNVVQL
RLAQMRDSGCSYAVVEASSHGLSPKTARLEDVIFDAGVFMNVTQEHLEFHGTIEQYRYDK
ANLFRALDKNPGKGFPIFGIVNYEDPSAPYFMEATQKNVYPFSTELKDLKKIEEYKGLFA
KDIEESSSGIKFTLCDFSSRKEYGCELKLAGIFNVKNILASVLAVQRITGLDIACIIEKL
PLVKPVKGRMMLIDEGQDFEVLIDYAHTPSSFMTIFPSIKERIKKSGGKVISLFGSGGER
DVKKRPEQGRIAALYSDIVILADEDPRGEDSVELLEMIAAGCPEKKRGEELFIIPDRPSA
IKKAFSLAGKNDAVLLLGKGHENSIIFKDRTMPYDEETTARKLLIGADCTNP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaatacacaaaatcgattgcggaatgcatcaaagctattgaagttgtaaattgtttt
ggaaacgataaatctcttatcaattctgtagagtatgattcacgtaaggttagggcttac
agttatgacgataagacgggcttaaaaaaaggagccgccttttttgctcttcccgggatt
cataccgacggaaaaaaatttataaattctgcaatcgaaaacggagccgtctgtattttt
tatgagggagatttaaataatcattcttgtgatgaaatttgttttgttcaggtgaacgat
gtgcgcaaaaccatgtccaaggtttctgcccttctttatgatgaaccgtcaaggacacta
ggcgtaataggtgttaccggaaccgaagggaagagcagcactgtttcttttatctttcag
cttttaaacctttgcggaaaaaaggcaggctttttttctaccgtagaatactccatagac
gggaacgtaattccgaacccggaacatcagactactcccgaatctaatgtcgttcagctg
cgtctggctcaaatgagggattcaggctgcagctatgccgtagttgaagcctcgtcgcac
ggtctttccccgaagactgcccgtcttgaagatgtgatttttgatgcaggtgtttttatg
aacgtaactcaggaacacttggaatttcacggaaccatcgagcagtaccgatatgataag
gccaatctttttagggctttggataaaaatccgggaaaaggatttcccatattcggaata
gtaaactatgaagatccgtccgccccttattttatggaagcaactcaaaaaaatgtctac
ccttttagcaccgagcttaaagacctaaaaaaaattgaagaatataaaggtctttttgca
aaggatattgaagagtcttcaagcggaattaaatttacgctttgcgatttttcttctaga
aaagaatacgggtgcgaattaaaacttgcaggaatctttaatgtaaaaaatattctcgcc
tcggtcttggcagtacaaagaattacgggccttgatatcgcgtgcataatcgaaaaactt
cctcttgtaaaacccgtaaagggaagaatgatgctgatagatgaggggcaggattttgag
gtgcttatcgattatgctcacacgccttcttcctttatgacaatttttccttcaataaaa
gaacgcataaaaaaatcgggaggaaaggtcataagtcttttcggttcaggcggagaaaga
gacgtaaaaaagaggccggagcagggaaggattgcagccctatattccgatattgtaatt
cttgcagacgaagatccgcgcggcgaggactccgttgaacttttggaaatgatagccgca
ggctgtcccgaaaaaaaacgcggagaagaactctttataatccccgaccgcccctctgca
atcaaaaaagccttcagtcttgcaggtaaaaacgatgcagtcctccttttgggaaagggt
catgaaaactccatcatctttaaagatagaaccatgccctacgatgaagaaaccacggca
agaaaattattaatcggcgcagactgtacaaatccgtaa

DBGET integrated database retrieval system