KEGG   Treponema denticola: TDE1236Help
Entry
TDE1236           CDS       T00157                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tde  Treponema denticola
Pathway
tde00010  Glycolysis / Gluconeogenesis
tde00051  Fructose and mannose metabolism
tde01100  Metabolic pathways
tde01110  Biosynthesis of secondary metabolites
tde01120  Microbial metabolism in diverse environments
tde01130  Biosynthesis of antibiotics
tde01200  Carbon metabolism
tde01230  Biosynthesis of amino acids
Module
tde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDE1236 (tpiA)
   00051 Fructose and mannose metabolism
    TDE1236 (tpiA)
   00562 Inositol phosphate metabolism
    TDE1236 (tpiA)
Enzymes [BR:tde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TDE1236 (tpiA)
Exosome [BR:tde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TDE1236 (tpiA)
  Exosomal proteins of bladder cancer cells
   TDE1236 (tpiA)
  Exosomal proteins of melanoma cells
   TDE1236 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 2741178
NCBI-ProteinID: NP_971843
UniProt: Q73NB9
Position
1269626..1270378
Genome map
AA seq 250 aa AA seqDB search
MKKFYIAANWKMNMNRAEAKQLATEMKAGLKDGKNKYMIAPSFTLLQDVASVLKGSNILL
GAQNMGLEEKGAHTGEVSVLQLLDVGVQAVILGHSERRHIYKETDDLINKKVKLALKHGL
EVILCVGELLEEREAGHAEAVCERQIKKGLAEVSAKDLDKVTIAYEPVWAIGTGKNASPE
DADAIHSSIRKTLAALYGEKAAKNMIIQYGGSMKPENAAGLLKKHNIDGGLIGGAGLKTE
TFLPIALFSE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagttttacattgcggcaaattggaagatgaatatgaatagggctgaggccaag
cagcttgcaacagaaatgaaggccggcctaaaagacggaaaaaataagtacatgatagct
ccttcatttactcttctgcaagatgttgcgtccgtgcttaaaggctccaatatcttgctg
ggtgctcaaaatatgggattggaagaaaagggcgctcataccggggaggtttccgttctt
cagcttttggatgtaggtgttcaagccgtaattttaggccattccgaaagaaggcatata
tacaaggaaacagatgaccttatcaataaaaaggtaaaacttgcattaaaacacggtctt
gaagttatcctctgtgtgggagagcttctcgaagagcgtgaagccggccatgccgaagcc
gtatgcgaaaggcagattaaaaaaggacttgctgaggtttctgcaaaagatttggataag
gtaacgattgcttatgagcctgtttgggcaataggaacgggaaaaaatgcgagccctgag
gatgctgatgccatccattcttcaataaggaagaccttagccgctctttacggagaaaaa
gctgctaaaaatatgataatccagtacggaggctctatgaaacctgaaaatgccgccggt
cttttaaaaaagcacaatattgacggaggcctaataggcggagccggtcttaaaacggaa
acatttttgcctatagccttgttttccgagtag

DBGET integrated database retrieval system