KEGG   Treponema denticola: TDE1236Help
Entry
TDE1236           CDS       T00157                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tde  Treponema denticola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDE1236 (tpiA)
   01230 Biosynthesis of amino acids
    TDE1236 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDE1236 (tpiA)
   00051 Fructose and mannose metabolism
    TDE1236 (tpiA)
   00562 Inositol phosphate metabolism
    TDE1236 (tpiA)
Enzymes [BR:tde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TDE1236 (tpiA)
Exosome [BR:tde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TDE1236 (tpiA)
  Exosomal proteins of bladder cancer cells
   TDE1236 (tpiA)
  Exosomal proteins of melanoma cells
   TDE1236 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269626..1270378
Genome map
AA seq 250 aa AA seqDB search
MKKFYIAANWKMNMNRAEAKQLATEMKAGLKDGKNKYMIAPSFTLLQDVASVLKGSNILL
GAQNMGLEEKGAHTGEVSVLQLLDVGVQAVILGHSERRHIYKETDDLINKKVKLALKHGL
EVILCVGELLEEREAGHAEAVCERQIKKGLAEVSAKDLDKVTIAYEPVWAIGTGKNASPE
DADAIHSSIRKTLAALYGEKAAKNMIIQYGGSMKPENAAGLLKKHNIDGGLIGGAGLKTE
TFLPIALFSE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagttttacattgcggcaaattggaagatgaatatgaatagggctgaggccaag
cagcttgcaacagaaatgaaggccggcctaaaagacggaaaaaataagtacatgatagct
ccttcatttactcttctgcaagatgttgcgtccgtgcttaaaggctccaatatcttgctg
ggtgctcaaaatatgggattggaagaaaagggcgctcataccggggaggtttccgttctt
cagcttttggatgtaggtgttcaagccgtaattttaggccattccgaaagaaggcatata
tacaaggaaacagatgaccttatcaataaaaaggtaaaacttgcattaaaacacggtctt
gaagttatcctctgtgtgggagagcttctcgaagagcgtgaagccggccatgccgaagcc
gtatgcgaaaggcagattaaaaaaggacttgctgaggtttctgcaaaagatttggataag
gtaacgattgcttatgagcctgtttgggcaataggaacgggaaaaaatgcgagccctgag
gatgctgatgccatccattcttcaataaggaagaccttagccgctctttacggagaaaaa
gctgctaaaaatatgataatccagtacggaggctctatgaaacctgaaaatgccgccggt
cttttaaaaaagcacaatattgacggaggcctaataggcggagccggtcttaaaacggaa
acatttttgcctatagccttgttttccgagtag

DBGET integrated database retrieval system