KEGG   Treponema denticola: TDE1453Help
Entry
TDE1453           CDS       T00157                                 

Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
tde  Treponema denticola
Pathway
tde00052  Galactose metabolism
tde00561  Glycerolipid metabolism
tde00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TDE1453
  Lipid metabolism
   00561 Glycerolipid metabolism
    TDE1453
   00600 Sphingolipid metabolism
    TDE1453
Enzymes [BR:tde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TDE1453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 Glyco_hydro_31 GHL10
Motif
Other DBs
NCBI-GeneID: 2741416
NCBI-ProteinID: NP_972059
UniProt: Q73MQ5
Position
1499252..1501576
Genome map
AA seq 774 aa AA seqDB search
MIQFEDDVFYLETENSSYWFRISPYGHLETVHYGKKMERGDIQGLLVKRTAQTGSSVCYD
EKAPLYVLDNIPLQWSGNGRGDYRYSPCEIRMPDSSFTHDFVYQSHKIEKGLKPMQTLPY
AIDGNEDAETLIINLKDINDVSLALYYTVFPSFNLITRRAVLTNNNEKALEIRRLMSMMI
DLPDRGFDMFTLDGSWIKEAHLHKKEISYGMWVNESTTGASSNRHNPGFLVAAHGAEEDR
GEVYGFNLIYSGNHLGFVQKSHLDLIRIGIGISPHCFSWDLKKGESFETPEALLSFSDRG
FNGLRSNMHGFINKCIVRGEWKEKERPVLINNWEADFFKFNRRSLLRSARQAKKLGLELF
VLDDGWFGDRNNDSAGLGDYRVNTKKLPGGIKKLADRVRKIGLDFGLWFEPEMVNEDSDL
FRSHPEWALKEPFREPVRGRHQLVLDLCLKEVRNYIVENVSRILDEADVSYVKWDMNRHI
SAAFSPSLKNQGEFYHRYILGLYEVLRRIFSPRPHILLESCSSGGNRFDLGMLCFSPQIW
TSDNTDPVERQEIQSSLSLLYPLSTMGAHVSASPHQQTLRQTSLSTRFNTACFGVLGYEL
DLKFLTHAEKKEIKEQISFYKKYRKIFQFGSFSVIGTHKDNQRHWQCSDGRTAVSGLFQM
KARTADGHSILKVKGMKENALYEVETKPQSLYIKRFGGLIKHVLPISLNPEGLVLRTVNK
YYALLDCVEKYRASGKLLDYGILLNNQFMGTYYNDKTHLWGDFGSCLFVTKEVI
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttgaagatgatgttttttatctggaaaccgagaactcaagctattggttc
cgtataagtccttacggccacttggaaaccgtgcattacggtaaaaagatggaaagaggc
gatatacagggtctccttgtaaaaagaacggcacagacaggttcttccgtttgctatgat
gaaaaagcccccctatatgtgcttgataatatccccttgcaatggtcgggaaatggcagg
ggggattaccgttattctccttgcgaaataagaatgcccgattcttcttttacgcacgat
tttgtttatcaatcccataagatagaaaagggcttgaaacctatgcagactcttccttac
gccattgacggaaatgaagacgccgaaacccttatcataaatttaaaagatataaacgat
gttagtcttgcactctactatacggtatttccgtcctttaatcttataacaaggcgtgct
gtcttgacaaataataatgaaaaagccttggaaatacgccgccttatgagtatgatgata
gatcttccggacaggggcttcgatatgttcacccttgacggaagctggattaaagaagct
catctccacaaaaaagaaatttcctatgggatgtgggtaaacgagtctacaaccggagca
agctctaaccgtcacaatccgggttttcttgttgcagctcacggagcagaggaggatagg
ggagaggtctacgggttcaaccttatctacagcggcaatcatttaggatttgttcaaaaa
agtcatttggacttaatccgcatcggtatcgggataagtcctcattgtttttcttgggat
ttaaaaaaaggtgaaagctttgaaacgcctgaggctcttctttctttttccgatagggga
tttaacgggcttcgttcaaatatgcacggctttataaataagtgtattgtaaggggtgaa
tggaaagaaaaagaaaggcctgttttaataaacaattgggaagccgatttttttaagttt
aaccgccgaagccttttacgctctgcccgtcaggcaaaaaaactagggcttgagcttttt
gtgcttgatgacggctggttcggagaccggaataacgatagtgcaggcctcggcgactat
cgggtaaatacaaaaaagctccccggcggaattaaaaaacttgccgacagggtgcgtaaa
atagggcttgacttcgggctttggtttgagcctgaaatggtaaacgaggacagcgatcta
ttccgttctcatcccgagtgggccttaaaagagcccttcagggagccggtcagaggaagg
catcagctcgtccttgacctttgtcttaaagaagtgaggaattatatagttgaaaatgtt
tcacggattttagatgaggcggatgtctcttatgtaaaatgggatatgaaccgtcacata
tcggcagctttttctccttctttaaaaaatcaaggagagttttatcaccgatatatttta
ggcctttatgaagtcttaaggaggattttttctcctcggcctcatatcctgcttgaaagt
tgttcttcaggaggaaaccgttttgatcttggaatgctttgcttttctccccagatatgg
acttcggataataccgaccctgtggaaaggcaggaaatacaaagctctttaagtctccta
tatccgctttctactatgggtgcccatgtttcggcctcgcctcatcagcagaccctaagg
caaacatccttgagtacccgctttaataccgcctgtttcggggtcttaggttatgaattg
gatctaaaatttttaacccatgccgaaaaaaaagaaataaaagaacaaatttctttttat
aaaaaatacagaaaaatttttcagttcggttctttttcggttataggtactcataaagat
aatcagaggcattggcaatgttctgacggcaggactgccgtatcaggcctttttcagatg
aaggcacggactgccgacgggcacagtattttaaaagttaaaggaatgaaggaaaatgcc
ttatacgaggttgaaacaaaacctcaaagcctctatataaagcgtttcggaggtttgatt
aaacatgtgcttcccatttctttaaatcctgagggacttgttttaagaacggtaaacaag
tattatgctcttttagattgtgtagaaaaatatcgagcttcaggaaagctgttggactac
ggtattcttttaaataatcagtttatgggcacttattataatgataagactcatctttgg
ggagacttcggttcctgtttatttgtaacgaaggaggtcatttaa

DBGET integrated database retrieval system