KEGG   Treponema denticola: TDE1453Help
Entry
TDE1453           CDS       T00157                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tde  Treponema denticola
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tde00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tde00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tde00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1499252..1501576
Genome map
AA seq 774 aa AA seqDB search
MIQFEDDVFYLETENSSYWFRISPYGHLETVHYGKKMERGDIQGLLVKRTAQTGSSVCYD
EKAPLYVLDNIPLQWSGNGRGDYRYSPCEIRMPDSSFTHDFVYQSHKIEKGLKPMQTLPY
AIDGNEDAETLIINLKDINDVSLALYYTVFPSFNLITRRAVLTNNNEKALEIRRLMSMMI
DLPDRGFDMFTLDGSWIKEAHLHKKEISYGMWVNESTTGASSNRHNPGFLVAAHGAEEDR
GEVYGFNLIYSGNHLGFVQKSHLDLIRIGIGISPHCFSWDLKKGESFETPEALLSFSDRG
FNGLRSNMHGFINKCIVRGEWKEKERPVLINNWEADFFKFNRRSLLRSARQAKKLGLELF
VLDDGWFGDRNNDSAGLGDYRVNTKKLPGGIKKLADRVRKIGLDFGLWFEPEMVNEDSDL
FRSHPEWALKEPFREPVRGRHQLVLDLCLKEVRNYIVENVSRILDEADVSYVKWDMNRHI
SAAFSPSLKNQGEFYHRYILGLYEVLRRIFSPRPHILLESCSSGGNRFDLGMLCFSPQIW
TSDNTDPVERQEIQSSLSLLYPLSTMGAHVSASPHQQTLRQTSLSTRFNTACFGVLGYEL
DLKFLTHAEKKEIKEQISFYKKYRKIFQFGSFSVIGTHKDNQRHWQCSDGRTAVSGLFQM
KARTADGHSILKVKGMKENALYEVETKPQSLYIKRFGGLIKHVLPISLNPEGLVLRTVNK
YYALLDCVEKYRASGKLLDYGILLNNQFMGTYYNDKTHLWGDFGSCLFVTKEVI
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttgaagatgatgttttttatctggaaaccgagaactcaagctattggttc
cgtataagtccttacggccacttggaaaccgtgcattacggtaaaaagatggaaagaggc
gatatacagggtctccttgtaaaaagaacggcacagacaggttcttccgtttgctatgat
gaaaaagcccccctatatgtgcttgataatatccccttgcaatggtcgggaaatggcagg
ggggattaccgttattctccttgcgaaataagaatgcccgattcttcttttacgcacgat
tttgtttatcaatcccataagatagaaaagggcttgaaacctatgcagactcttccttac
gccattgacggaaatgaagacgccgaaacccttatcataaatttaaaagatataaacgat
gttagtcttgcactctactatacggtatttccgtcctttaatcttataacaaggcgtgct
gtcttgacaaataataatgaaaaagccttggaaatacgccgccttatgagtatgatgata
gatcttccggacaggggcttcgatatgttcacccttgacggaagctggattaaagaagct
catctccacaaaaaagaaatttcctatgggatgtgggtaaacgagtctacaaccggagca
agctctaaccgtcacaatccgggttttcttgttgcagctcacggagcagaggaggatagg
ggagaggtctacgggttcaaccttatctacagcggcaatcatttaggatttgttcaaaaa
agtcatttggacttaatccgcatcggtatcgggataagtcctcattgtttttcttgggat
ttaaaaaaaggtgaaagctttgaaacgcctgaggctcttctttctttttccgatagggga
tttaacgggcttcgttcaaatatgcacggctttataaataagtgtattgtaaggggtgaa
tggaaagaaaaagaaaggcctgttttaataaacaattgggaagccgatttttttaagttt
aaccgccgaagccttttacgctctgcccgtcaggcaaaaaaactagggcttgagcttttt
gtgcttgatgacggctggttcggagaccggaataacgatagtgcaggcctcggcgactat
cgggtaaatacaaaaaagctccccggcggaattaaaaaacttgccgacagggtgcgtaaa
atagggcttgacttcgggctttggtttgagcctgaaatggtaaacgaggacagcgatcta
ttccgttctcatcccgagtgggccttaaaagagcccttcagggagccggtcagaggaagg
catcagctcgtccttgacctttgtcttaaagaagtgaggaattatatagttgaaaatgtt
tcacggattttagatgaggcggatgtctcttatgtaaaatgggatatgaaccgtcacata
tcggcagctttttctccttctttaaaaaatcaaggagagttttatcaccgatatatttta
ggcctttatgaagtcttaaggaggattttttctcctcggcctcatatcctgcttgaaagt
tgttcttcaggaggaaaccgttttgatcttggaatgctttgcttttctccccagatatgg
acttcggataataccgaccctgtggaaaggcaggaaatacaaagctctttaagtctccta
tatccgctttctactatgggtgcccatgtttcggcctcgcctcatcagcagaccctaagg
caaacatccttgagtacccgctttaataccgcctgtttcggggtcttaggttatgaattg
gatctaaaatttttaacccatgccgaaaaaaaagaaataaaagaacaaatttctttttat
aaaaaatacagaaaaatttttcagttcggttctttttcggttataggtactcataaagat
aatcagaggcattggcaatgttctgacggcaggactgccgtatcaggcctttttcagatg
aaggcacggactgccgacgggcacagtattttaaaagttaaaggaatgaaggaaaatgcc
ttatacgaggttgaaacaaaacctcaaagcctctatataaagcgtttcggaggtttgatt
aaacatgtgcttcccatttctttaaatcctgagggacttgttttaagaacggtaaacaag
tattatgctcttttagattgtgtagaaaaatatcgagcttcaggaaagctgttggactac
ggtattcttttaaataatcagtttatgggcacttattataatgataagactcatctttgg
ggagacttcggttcctgtttatttgtaacgaaggaggtcatttaa

DBGET integrated database retrieval system