KEGG   Treponema denticola: TDE1549Help
Entry
TDE1549           CDS       T00157                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tde  Treponema denticola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TDE1549 (recR)
DNA repair and recombination proteins [BR:tde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TDE1549 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1592280..1592867
Genome map
AA seq 195 aa AA seqDB search
MNAIDAVIDSFSRLPGIGHKSAARIAYHLLKQGPADALRLAEAVSTLHEKIHPCTICGSY
TEDEICSICADETRDRATICVVGFPQDVNTISSIPEYRGLFHVLGGLIAPLEGIGPDQLH
ISELIRRIHEGGITEVILATNPTIEGDTTALYIQKILQDLPVNITRLASGLPVGGDLEYA
DRLTLARSLNGRIKF
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctattgatgcagttatagactcattttcccgccttcccggtataggtcataag
agtgctgcccgcatcgcctatcatcttctaaaacaagggcctgcggatgccttgcgttta
gcggaagctgtttctaccttacacgagaaaattcatccttgtactatatgcggttcttat
acggaagatgagatttgttctatttgtgcggatgaaacaagggatagggcaactatctgt
gtagtaggctttcctcaggatgtgaatacaatttcttcaatccccgaatatagaggattg
ttccatgttttgggcggacttatagctccccttgaaggtataggccccgatcaattacat
ataagtgagcttatcagacgtattcatgaaggcggaattaccgaggttattcttgcaacc
aaccctacgattgaaggcgatactacggccctgtacattcaaaaaatattgcaggacctg
cctgttaatataacaaggcttgcctcaggcttacctgtcggaggcgatttggaatatgcc
gatcgtttgacccttgcaaggagtttaaacggccgcattaaattttaa

DBGET integrated database retrieval system