KEGG   Treponema denticola: TDE1729Help
Entry
TDE1729           CDS       T00157                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tde  Treponema denticola
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TDE1729
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TDE1729
Enzymes [BR:tde01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TDE1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1783379..1783846)
Genome map
AA seq 155 aa AA seqDB search
MGIYNYTVKDSLGNDFSFNDYKDYVILIVNTACEUGLTPHFQGLEALYKEYRDKKFLVAA
FPCNQFGGQDPGTNEEIRNFAQSKYGVSFPIMAKIEVNGENTEPIFSFLKKASNGEDIKW
NFAKFLVDKTGERVTAYAPTVAPEDLKKDIEKLLN
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgggaatttataattacacagttaaggacagcttaggaaatgacttttcttttaatgat
tacaaagattatgttattttaatcgtgaacacggcttgtgagtgaggacttactcctcac
ttccaaggtttggaagcattatacaaagaatacagggataaaaaattccttgttgcagct
tttccatgtaatcaattcggcggtcaagatccgggcacaaacgaggaaatcagaaatttt
gctcaaagtaagtatggggtttctttccccataatggcaaaaattgaagtcaacggtgaa
aataccgaacctattttttcttttttaaaaaaagcttcaaacggtgaagacataaaatgg
aattttgccaaattcttagtcgataaaacgggagaaagagttaccgcctatgctccgact
gttgcacctgaagacttaaaaaaagatattgaaaaactattgaattag

DBGET integrated database retrieval system