KEGG   Treponema denticola: TDE1863Help
Entry
TDE1863           CDS       T00157                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tde  Treponema denticola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TDE1863 (ruvA)
Enzymes [BR:tde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TDE1863 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1888064..1888669)
Genome map
AA seq 201 aa AA seqDB search
MFNSISGILSGKTTDSVYVENSGIEWEIFVSALALDALGTVGKEVKVYTWLYHREDQMRL
FGFPNQAERSLFLDLTKVEGVGPRQALKIMSGLNSSSLEKALEEGDLDTLQKAPGVGKKT
AQKMILALKGKLTNLNEVSSKGQASVSCEYEDIVTALTEMGFERKSVIVQVEKIAEEMKA
AGSDPLKNEEELFRRSIVALS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacagcatttcaggaattttaagcggaaaaacaaccgattccgtctatgttgaa
aattcaggtattgagtgggaaatctttgtttcggccttggccctcgatgccttaggcact
gtcggaaaagaggtaaaggtttatacatggctttatcacagggaagaccagatgaggctt
ttcggctttcccaatcaggcagaacgctccttgtttttggatcttacaaaggttgagggg
gtagggccccgtcaagccttaaagataatgtcggggcttaattcatcttcccttgaaaaa
gccttggaggaaggcgaccttgacacccttcaaaaggctcccggagtaggcaaaaagact
gcccaaaaaatgattcttgccttaaaaggaaaacttaccaatctaaacgaagtttcctca
aaggggcaggcttccgtttcttgcgaatatgaagacatagttacggccttaaccgaaatg
ggctttgaaagaaaatccgtaatcgttcaagtcgaaaaaatagccgaagaaatgaaggcc
gcaggttccgatcctcttaaaaacgaagaagaactttttagacgctcaatcgtcgctttg
agttga

DBGET integrated database retrieval system