KEGG   Treponema denticola: TDE2192Help
Entry
TDE2192           CDS       T00157                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tde  Treponema denticola
Pathway
tde00260  Glycine, serine and threonine metabolism
tde00750  Vitamin B6 metabolism
tde01100  Metabolic pathways
tde01110  Biosynthesis of secondary metabolites
tde01120  Microbial metabolism in diverse environments
tde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TDE2192
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TDE2192
Enzymes [BR:tde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TDE2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 2740214
NCBI-ProteinID: NP_972793
UniProt: Q73KM5
Position
2227901..2229319
Genome map
AA seq 472 aa AA seqDB search
MKFYDIANKNILVSFKEAVLRGFNSETGGVFMPAELGKISPAMIYRNPPSSFRDICFEII
KNFCGDEIPEDDLMSIIAQFYPHRLPINPIAPTTYVLELFHGPTCNYKDIGSGFLAYLLE
YFNKDEDGDINLIVPASGERACAIASAVSQVKRVNALLLYPKDSLTEIQENFLSSMPKNV
YPICVEGSFEDCENLVDKALKDEDLLKKLKLVSGGALNIAPLLPQVAFFVYAALTVLYRS
DYDNKIENPSIITSIPSGSFSALTAALIAKKMGTPIKGLISTENENHALSDWLTAGDLKK
RTAIKTNTPALDIPNTINFKRMLQIYDVEELRRLIIPYWLDGMGTISSVRTCNERTGYII
DPYGAMAWTAWQDVYNGALNSLKRKTSENDEDPGIPLKYANIETWASAIHRSSMVGIVLQ
TSHPAKFPEIMKPAIGRPPSLPDKLESLQYRLLKAVNILPDYSMFKEWALSH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttacgatatagccaataaaaatatactggtctcttttaaagaagctgtgcta
agaggttttaactctgaaacggggggagtttttatgccggcggagctcggaaaaataagt
ccggcaatgatttatcgaaatcccccttcttcttttagggatatatgctttgaaattata
aaaaacttttgcggcgatgaaattcctgaagacgatctaatgtctataatagctcaattt
tatcctcacaggctcccgataaacccgatagcgccgacaacctatgttttggagcttttt
cacgggcccacctgtaactataaggacataggatcaggctttttagcctatcttttagag
tactttaataaagacgaagacggagatattaacctcattgtaccggcctccggcgaaaga
gcttgtgccattgcatcagccgtttcccaagtgaagagagttaatgcccttcttttatac
cccaaggactccttaacggaaatacaggaaaactttctttcttcaatgcctaaaaatgta
tatccgatttgtgtggaaggatcctttgaagattgtgaaaatcttgtggataaagcactc
aaagatgaagatttattgaaaaaactaaaacttgtttcaggaggagccttaaacatagcg
ccccttttacctcaagttgctttttttgtctatgcagccttaaccgtattataccgcagc
gattacgataacaaaattgaaaatccttcaatcataacttcaataccgtcaggaagtttt
tcggcccttacggcagccctgattgcaaaaaaaatgggaaccccgatcaaagggcttatt
tcgaccgaaaacgaaaatcatgctctttcggattggctcacagccggagatttaaaaaaa
agaacggcaataaaaaccaatacgccggctctggatattcccaatacaatcaactttaag
cggatgcttcaaatttacgatgttgaagaacttagaagacttataattccttattggctt
gacggtatgggaacaatatcttccgtaagaacatgtaatgaaagaacaggctatataata
gatccttacggtgctatggcttggacagcctggcaggatgtctataatggggcactgaat
tcattaaagagaaaaacatcagaaaatgatgaggacccggggatacctttaaaatatgca
aatattgaaacatgggcatctgcaattcacagaagcagtatggtgggaatagttctacaa
acctctcatcctgcaaagttccccgaaattatgaaaccggccattggcaggccgccgtct
ttacccgataaacttgaaagtttacaatatcggcttttaaaagcggttaatatcctgccc
gattactcaatgtttaaagaatgggctttgtcccactaa

DBGET integrated database retrieval system