KEGG   Treponema denticola: TDE2192Help
Entry
TDE2192           CDS       T00157                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tde  Treponema denticola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TDE2192
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TDE2192
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TDE2192
Enzymes [BR:tde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TDE2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2227901..2229319
Genome map
AA seq 472 aa AA seqDB search
MKFYDIANKNILVSFKEAVLRGFNSETGGVFMPAELGKISPAMIYRNPPSSFRDICFEII
KNFCGDEIPEDDLMSIIAQFYPHRLPINPIAPTTYVLELFHGPTCNYKDIGSGFLAYLLE
YFNKDEDGDINLIVPASGERACAIASAVSQVKRVNALLLYPKDSLTEIQENFLSSMPKNV
YPICVEGSFEDCENLVDKALKDEDLLKKLKLVSGGALNIAPLLPQVAFFVYAALTVLYRS
DYDNKIENPSIITSIPSGSFSALTAALIAKKMGTPIKGLISTENENHALSDWLTAGDLKK
RTAIKTNTPALDIPNTINFKRMLQIYDVEELRRLIIPYWLDGMGTISSVRTCNERTGYII
DPYGAMAWTAWQDVYNGALNSLKRKTSENDEDPGIPLKYANIETWASAIHRSSMVGIVLQ
TSHPAKFPEIMKPAIGRPPSLPDKLESLQYRLLKAVNILPDYSMFKEWALSH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttacgatatagccaataaaaatatactggtctcttttaaagaagctgtgcta
agaggttttaactctgaaacggggggagtttttatgccggcggagctcggaaaaataagt
ccggcaatgatttatcgaaatcccccttcttcttttagggatatatgctttgaaattata
aaaaacttttgcggcgatgaaattcctgaagacgatctaatgtctataatagctcaattt
tatcctcacaggctcccgataaacccgatagcgccgacaacctatgttttggagcttttt
cacgggcccacctgtaactataaggacataggatcaggctttttagcctatcttttagag
tactttaataaagacgaagacggagatattaacctcattgtaccggcctccggcgaaaga
gcttgtgccattgcatcagccgtttcccaagtgaagagagttaatgcccttcttttatac
cccaaggactccttaacggaaatacaggaaaactttctttcttcaatgcctaaaaatgta
tatccgatttgtgtggaaggatcctttgaagattgtgaaaatcttgtggataaagcactc
aaagatgaagatttattgaaaaaactaaaacttgtttcaggaggagccttaaacatagcg
ccccttttacctcaagttgctttttttgtctatgcagccttaaccgtattataccgcagc
gattacgataacaaaattgaaaatccttcaatcataacttcaataccgtcaggaagtttt
tcggcccttacggcagccctgattgcaaaaaaaatgggaaccccgatcaaagggcttatt
tcgaccgaaaacgaaaatcatgctctttcggattggctcacagccggagatttaaaaaaa
agaacggcaataaaaaccaatacgccggctctggatattcccaatacaatcaactttaag
cggatgcttcaaatttacgatgttgaagaacttagaagacttataattccttattggctt
gacggtatgggaacaatatcttccgtaagaacatgtaatgaaagaacaggctatataata
gatccttacggtgctatggcttggacagcctggcaggatgtctataatggggcactgaat
tcattaaagagaaaaacatcagaaaatgatgaggacccggggatacctttaaaatatgca
aatattgaaacatgggcatctgcaattcacagaagcagtatggtgggaatagttctacaa
acctctcatcctgcaaagttccccgaaattatgaaaccggccattggcaggccgccgtct
ttacccgataaacttgaaagtttacaatatcggcttttaaaagcggttaatatcctgccc
gattactcaatgtttaaagaatgggctttgtcccactaa

DBGET integrated database retrieval system