KEGG   Treponema denticola: TDE2387Help
Entry
TDE2387           CDS       T00157                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tde  Treponema denticola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TDE2387 (malQ)
Enzymes [BR:tde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TDE2387 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2416180..2417802
Genome map
AA seq 540 aa AA seqDB search
MKRSSGIILHPTSLPNDEGIGTIGKEAFAFIDWLKKTRTGVWQMLPIGPTGYGDSPYASF
SAFAGNPYLISLQDLYEKGFLEKRDFTEYKKIVQENTDPKRADFGLIHYHKTKMLKKAAA
SLLHKMERDSSSKEELENFYQEESFWLDGYAAFMTIKEDYEERLDKENLVQGIWNEVWPK
ELALNKKDKIKEFLGKHSEEYETQKIIQFFFFSQWKKLKEYAEKNGIQLIGDIPIFAAMD
SADVWQNQSLFLLDKEATPKAVAGVPPDFFSPTGQLWGNPLYDWAKMKKDSYLWWKARIR
HTLKLFDIIRLDHFRGFEAFWAIPQGAKTAQEGKWVKGPDHHFFEEIQKDLISLDEKYRG
ELPILTEDLGVITPEVARLRDDFNFPTMKILQFAFDLNELKSENLTNPYLPHNHKKNCAV
YTGSHDNDTIMGWLEGSSDEMLKFIYTYLYGKKADKRICSILNTYEFKKELASEIIRKAF
SSVADFAAVQMQDLLFLNSEARMNAPSTVGKNWQWRVTGSYENCEMTEKLELWNVLYNRV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagttcaggtattattttacatcccacctcgttacctaatgatgaaggcata
gggacaatcggtaaagaggcttttgcctttatcgattggttaaaaaaaacaagaacggga
gtttggcagatgcttccgattggccccaccggttatggagactcaccctacgcttctttt
tcggcctttgcaggaaacccttatcttataagtcttcaagatctttatgaaaaaggcttt
ttagaaaaaagagattttaccgaatacaaaaaaatcgtacaagaaaatactgatcctaaa
agagcggatttcggtttaatccattaccataaaacaaaaatgttaaaaaaagcggcagca
tctttattgcacaaaatggaaagagactcatcttcaaaagaagaacttgaaaatttctac
caagaagaaagtttttggctggacggatatgcagcctttatgacaattaaagaagactat
gaagaaagactagataaagaaaatttagtgcaaggaatctggaatgaagtttggcccaag
gagcttgccttaaataaaaaagataagataaaagaatttctaggcaaacactccgaagaa
tatgaaacccaaaagattatacagtttttctttttttcgcaatggaaaaaattaaaagaa
tacgctgaaaaaaacggtatacaacttataggagatattccgatatttgcggcaatggat
tcagccgatgtttggcaaaatcaaagcttatttttactggacaaagaagctacacctaaa
gccgtcgccggtgtacctcccgacttttttagccctacgggacagctttggggcaaccct
ctttatgactgggctaagatgaaaaaggacagctacctatggtggaaggcccgcataaga
cataccctaaaactattcgacataatacgcctcgaccattttagaggctttgaagccttt
tgggctatcccccaaggtgcaaaaactgctcaagaaggaaaatgggtgaaaggccctgac
catcatttttttgaagaaatacaaaaggatctgatttcattggatgaaaaatacaggggc
gagcttcctatactaactgaagacttgggagttataacccctgaagttgcccgcctacga
gatgattttaatttcccgacgatgaagatattgcaatttgcctttgacttaaacgaatta
aaatcggaaaatctgactaatccttatctgcctcataaccacaaaaaaaactgtgccgta
tataccggttcccacgataacgacacaatcatgggttggcttgaaggttcttccgatgag
atgctgaaatttatttatacctatctttatggaaaaaaagcggataaaagaatttgctcc
attttaaacacttatgaatttaaaaaagaattagcctccgaaataatccgaaaagcgttt
tcttccgtggcggattttgcagccgtgcagatgcaggaccttttgtttttaaattctgaa
gcaagaatgaatgcaccttcaacagtcggaaaaaactggcaatggagagtaaccgggtct
tatgaaaactgcgagatgaccgaaaaattggagctttggaatgttttgtacaatagggtt
taa

DBGET integrated database retrieval system