KEGG   Treponema denticola: TDE2387Help
Entry
TDE2387           CDS       T00157                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tde  Treponema denticola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2416180..2417802
Genome map
AA seq 540 aa AA seqDB search
MKRSSGIILHPTSLPNDEGIGTIGKEAFAFIDWLKKTRTGVWQMLPIGPTGYGDSPYASF
SAFAGNPYLISLQDLYEKGFLEKRDFTEYKKIVQENTDPKRADFGLIHYHKTKMLKKAAA
SLLHKMERDSSSKEELENFYQEESFWLDGYAAFMTIKEDYEERLDKENLVQGIWNEVWPK
ELALNKKDKIKEFLGKHSEEYETQKIIQFFFFSQWKKLKEYAEKNGIQLIGDIPIFAAMD
SADVWQNQSLFLLDKEATPKAVAGVPPDFFSPTGQLWGNPLYDWAKMKKDSYLWWKARIR
HTLKLFDIIRLDHFRGFEAFWAIPQGAKTAQEGKWVKGPDHHFFEEIQKDLISLDEKYRG
ELPILTEDLGVITPEVARLRDDFNFPTMKILQFAFDLNELKSENLTNPYLPHNHKKNCAV
YTGSHDNDTIMGWLEGSSDEMLKFIYTYLYGKKADKRICSILNTYEFKKELASEIIRKAF
SSVADFAAVQMQDLLFLNSEARMNAPSTVGKNWQWRVTGSYENCEMTEKLELWNVLYNRV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagttcaggtattattttacatcccacctcgttacctaatgatgaaggcata
gggacaatcggtaaagaggcttttgcctttatcgattggttaaaaaaaacaagaacggga
gtttggcagatgcttccgattggccccaccggttatggagactcaccctacgcttctttt
tcggcctttgcaggaaacccttatcttataagtcttcaagatctttatgaaaaaggcttt
ttagaaaaaagagattttaccgaatacaaaaaaatcgtacaagaaaatactgatcctaaa
agagcggatttcggtttaatccattaccataaaacaaaaatgttaaaaaaagcggcagca
tctttattgcacaaaatggaaagagactcatcttcaaaagaagaacttgaaaatttctac
caagaagaaagtttttggctggacggatatgcagcctttatgacaattaaagaagactat
gaagaaagactagataaagaaaatttagtgcaaggaatctggaatgaagtttggcccaag
gagcttgccttaaataaaaaagataagataaaagaatttctaggcaaacactccgaagaa
tatgaaacccaaaagattatacagtttttctttttttcgcaatggaaaaaattaaaagaa
tacgctgaaaaaaacggtatacaacttataggagatattccgatatttgcggcaatggat
tcagccgatgtttggcaaaatcaaagcttatttttactggacaaagaagctacacctaaa
gccgtcgccggtgtacctcccgacttttttagccctacgggacagctttggggcaaccct
ctttatgactgggctaagatgaaaaaggacagctacctatggtggaaggcccgcataaga
cataccctaaaactattcgacataatacgcctcgaccattttagaggctttgaagccttt
tgggctatcccccaaggtgcaaaaactgctcaagaaggaaaatgggtgaaaggccctgac
catcatttttttgaagaaatacaaaaggatctgatttcattggatgaaaaatacaggggc
gagcttcctatactaactgaagacttgggagttataacccctgaagttgcccgcctacga
gatgattttaatttcccgacgatgaagatattgcaatttgcctttgacttaaacgaatta
aaatcggaaaatctgactaatccttatctgcctcataaccacaaaaaaaactgtgccgta
tataccggttcccacgataacgacacaatcatgggttggcttgaaggttcttccgatgag
atgctgaaatttatttatacctatctttatggaaaaaaagcggataaaagaatttgctcc
attttaaacacttatgaatttaaaaaagaattagcctccgaaataatccgaaaagcgttt
tcttccgtggcggattttgcagccgtgcagatgcaggaccttttgtttttaaattctgaa
gcaagaatgaatgcaccttcaacagtcggaaaaaactggcaatggagagtaaccgggtct
tatgaaaactgcgagatgaccgaaaaattggagctttggaatgttttgtacaatagggtt
taa

DBGET integrated database retrieval system