KEGG   Treponema denticola: TDE2676Help
Entry
TDE2676           CDS       T00157                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tde  Treponema denticola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tde01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tde00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tde00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2714425..2715738
Genome map
AA seq 437 aa AA seqDB search
MDLVSTRNNNKIVSFYEAVTNCMPADGGLYIPKEALDLSDWTYHLNETSSFTSITGALTS
AILREEFSPAVSERIAVSAFGNYSPRVRQLDERLFLLDLFHGPTGCHRDFGFLWFASVLE
HILTITDKKAIVLGTGTKKNGQSMAAAFWNKKRVKTLLIHPKGYASGIPEEYLAENGGSI
YSVECEGDVKDVENLKRSVYLDRNLVEKYGLTLANTVNIGRLLPQIFFYFYAFTRFKKHI
FGEIYYALHSGNYGNLAAGLFAWKSGLSLNGFITDSTPELSVNKDGDCFCKTMEIPLSQR
SAADPVSPSNIERLEQIFEISPAIMKALIFPKQVDPKDYKELIRKAYQRYGIMIDTSTAA
AYGAAIKSKILKNKGPETLVLISKDHPAFEADIIEEACGEKPNQPEYMSGLDKPIKNIKK
IQASKKEIENMLEYMER
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtaagcacacgaaacaataataagattgtatccttttatgaggcagtaaca
aactgtatgccggcagacggggggctttatatacccaaagaagccttggacttaagtgat
tggacctatcatcttaacgaaacttcaagttttacatctattacgggagccttaacctct
gcaatcctgcgagaggaattcagccctgccgtttcggaacgtattgccgtttcagctttt
ggaaattacagtccgagggtgcgccaattggatgaaagactctttttgctggaccttttt
cacgggccgaccggctgccacagagatttcggctttttatggtttgcttcagttcttgaa
catattttaaccataaccgataaaaaagccatagttttaggaacaggaaccaaaaaaaac
ggtcaaagtatggcggccgctttttggaacaaaaaaagggtaaagactcttttaattcac
cccaaaggttatgcctccggtataccggaagaatatttagcagaaaacggcggctctatt
tactctgtagaatgtgagggagatgtaaaggatgtcgaaaacttaaaaaggtccgtatat
cttgacagaaatcttgtagaaaaatacggtctgactttagcaaatactgtaaacataggc
agacttttaccccaaatatttttctatttttatgcttttacccgctttaaaaaacacatt
ttcggcgaaatctattacgcccttcactccggtaattacggaaaccttgcagcggggctt
tttgcatggaagagcggtctttccttaaacgggtttattaccgattctacgcctgaacta
tcggtaaacaaggacggagactgcttttgcaaaacaatggaaattcctttgagccaaaga
agtgcagcagatcctgtaagtccctcaaatattgagcgcttggaacagatttttgaaata
agcccggcaattatgaaggccttgatttttcctaagcaggtagatccgaaggattataag
gagctcataagaaaggcctatcaacgatatggaattatgatagatacttcgacggctgca
gcctatggagccgccatcaaaagtaaaattttaaaaaataagggcccggaaacccttgtt
cttatttcaaaagatcatccggcctttgaagccgatataatcgaggaggcctgcggcgaa
aaacctaatcaaccggaatacatgagcggtttagacaaacctataaaaaatataaaaaag
atacaggcatctaaaaaagaaattgaaaatatgctagaatatatggagaggtag

DBGET integrated database retrieval system