KEGG   Treponema denticola: TDE2676Help
Entry
TDE2676           CDS       T00157                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tde  Treponema denticola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TDE2676
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TDE2676
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TDE2676
Enzymes [BR:tde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TDE2676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2714425..2715738
Genome map
AA seq 437 aa AA seqDB search
MDLVSTRNNNKIVSFYEAVTNCMPADGGLYIPKEALDLSDWTYHLNETSSFTSITGALTS
AILREEFSPAVSERIAVSAFGNYSPRVRQLDERLFLLDLFHGPTGCHRDFGFLWFASVLE
HILTITDKKAIVLGTGTKKNGQSMAAAFWNKKRVKTLLIHPKGYASGIPEEYLAENGGSI
YSVECEGDVKDVENLKRSVYLDRNLVEKYGLTLANTVNIGRLLPQIFFYFYAFTRFKKHI
FGEIYYALHSGNYGNLAAGLFAWKSGLSLNGFITDSTPELSVNKDGDCFCKTMEIPLSQR
SAADPVSPSNIERLEQIFEISPAIMKALIFPKQVDPKDYKELIRKAYQRYGIMIDTSTAA
AYGAAIKSKILKNKGPETLVLISKDHPAFEADIIEEACGEKPNQPEYMSGLDKPIKNIKK
IQASKKEIENMLEYMER
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtaagcacacgaaacaataataagattgtatccttttatgaggcagtaaca
aactgtatgccggcagacggggggctttatatacccaaagaagccttggacttaagtgat
tggacctatcatcttaacgaaacttcaagttttacatctattacgggagccttaacctct
gcaatcctgcgagaggaattcagccctgccgtttcggaacgtattgccgtttcagctttt
ggaaattacagtccgagggtgcgccaattggatgaaagactctttttgctggaccttttt
cacgggccgaccggctgccacagagatttcggctttttatggtttgcttcagttcttgaa
catattttaaccataaccgataaaaaagccatagttttaggaacaggaaccaaaaaaaac
ggtcaaagtatggcggccgctttttggaacaaaaaaagggtaaagactcttttaattcac
cccaaaggttatgcctccggtataccggaagaatatttagcagaaaacggcggctctatt
tactctgtagaatgtgagggagatgtaaaggatgtcgaaaacttaaaaaggtccgtatat
cttgacagaaatcttgtagaaaaatacggtctgactttagcaaatactgtaaacataggc
agacttttaccccaaatatttttctatttttatgcttttacccgctttaaaaaacacatt
ttcggcgaaatctattacgcccttcactccggtaattacggaaaccttgcagcggggctt
tttgcatggaagagcggtctttccttaaacgggtttattaccgattctacgcctgaacta
tcggtaaacaaggacggagactgcttttgcaaaacaatggaaattcctttgagccaaaga
agtgcagcagatcctgtaagtccctcaaatattgagcgcttggaacagatttttgaaata
agcccggcaattatgaaggccttgatttttcctaagcaggtagatccgaaggattataag
gagctcataagaaaggcctatcaacgatatggaattatgatagatacttcgacggctgca
gcctatggagccgccatcaaaagtaaaattttaaaaaataagggcccggaaacccttgtt
cttatttcaaaagatcatccggcctttgaagccgatataatcgaggaggcctgcggcgaa
aaacctaatcaaccggaatacatgagcggtttagacaaacctataaaaaatataaaaaag
atacaggcatctaaaaaagaaattgaaaatatgctagaatatatggagaggtag

DBGET integrated database retrieval system