KEGG   Treponema denticola: TDE2687Help
Entry
TDE2687           CDS       T00157                                 

Definition
L-threonine-O-3-phosphate decarboxylase
Orthology
K04720  
threonine-phosphate decarboxylase [EC:4.1.1.81]
Organism
tde  Treponema denticola
Pathway
Porphyrin and chlorophyll metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tde00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2727286..2728344)
Genome map
AA seq 352 aa AA seqDB search
MEHGGVLSYKKKDEVLIDFSSNINPLMAPKGLKKALSASFNNLLVYPDIRYRSLKKVTAQ
YLKCRPENIVLGNGAVEIIDNFCSMFKRVVLCTPCFSEYGLRALVHNKPVLELPYLPDFL
PDIAGLEKKLRAGDLLILGNPNNPTGLRIEKTALLQIYSLVQKTGVFLLLDEAFYEFCPP
DYDSIALFKKDGYKNICIIRAATKFFGLPGIRLGYACTSTDTAAALSKIEMAWHINAFAE
AAAPAIFFDEDFIAKSKAYIQKERVFLLENIEKYGTSGEIKLQTYKSQCNFILLKVLNAK
DEDALKFFEKKGILIRTCSSFKTLGDNHIRIAVRSHKDNCKFINAISSKRSK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttggaacacggcggggttttgtcctataaaaagaaggacgaagttttaattgattttagt
agtaatataaatcctctaatggcacctaagggcttaaaaaaggccttaagtgcctctttt
aataaccttttggtttatcccgatatccgttaccgctcgctaaaaaaggtaacggctcaa
tatttaaaatgcagacctgaaaatattgttttggggaatggggctgtagaaataatcgat
aatttttgttcaatgtttaagagggttgttttatgcacgccctgtttttcggaatacgga
ttaagggctcttgtgcataataaaccggttttagagcttccttatcttcccgattttttg
cccgatattgccggccttgaaaaaaaactgagggcgggcgaccttctcatcttggggaat
ccgaataatcccacaggcttaagaatagaaaaaactgctcttttacaaatttattctctt
gtacaaaaaacaggggtttttttgcttttagatgaggctttttacgagttttgcccgcct
gactatgacagcatagctctgtttaaaaaagacggctataaaaatatctgtataataagg
gctgcaaccaaattttttggtcttccggggatacgcttaggctatgcctgtacctcaacc
gatacggcagccgctctttctaaaatcgagatggcttggcacataaacgcctttgcagaa
gctgccgctcctgcaatcttttttgatgaggactttatagcaaaaagcaaggcctatatt
caaaaagaaagagtttttttgctcgaaaatattgaaaaatacggaacaagcggcgagata
aaattacaaacttataaaagtcagtgcaattttattcttcttaaagttttaaatgcaaaa
gatgaagatgctttaaagttttttgaaaaaaagggaatcttaatcagaacctgcagcagt
tttaaaactctcggagataatcatatcagaattgccgtacgttctcataaagataattgt
aaatttattaacgcaataagctctaaaaggtcaaaataa

DBGET integrated database retrieval system