KEGG   Treponema denticola: TDE2697Help
Entry
TDE2697           CDS       T00157                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
tde  Treponema denticola
Brite
Enzymes [BR:tde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TDE2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2740400..2741173
Genome map
AA seq 257 aa AA seqDB search
MERLIFIFNITQIVLFGVGLICFVVLFFVPAGYGKMINKKWGFSFNNKIAWFLMEVPTLI
TMIVLMCVWAKPENFVRIIIGLFFVLHYAQRVFIFPFLLKGKSKMPILIVLMGITFNTIN
AFLIGAWLFYLSPKTMYPISWLYDPRFIIGALVFLLGMAINIDSDKYIRSLRKPGDTAHY
FPHKRMYKYVSSANYFGEILEWFGFALLSWSFVGLLFAFWTCANLVPRAYTINKRYREEF
PEEFAALKPKRVFPFIF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactgatatttatatttaatattacgcagattgtcttattcggcgtaggctta
atttgttttgtagtattgttttttgttccggccggatacggtaagatgataaataaaaaa
tggggattttcttttaacaataaaattgcgtggtttttaatggaagttcctacacttatc
actatgattgtcctaatgtgtgtatgggctaaacctgaaaattttgtgagaattataata
ggccttttttttgtgctgcattatgctcaaagagtttttatatttccttttttacttaag
ggaaaaagtaagatgcccatcctcatcgttttgatgggaatcacatttaatacgataaat
gcctttttaataggtgcatggcttttttacctttcccccaagaccatgtaccccatctcg
tggctttatgacccccgatttataatcggagctcttgtttttttgctcggaatggccata
aacatagactcggacaagtatatacgttccttacgaaagccgggagacacggcacactat
tttccgcataaacggatgtacaaatatgtatccagcgccaattatttcggtgaaatattg
gaatggttcggctttgccctcctatcatggagctttgtaggccttttgtttgcattttgg
acctgtgccaaccttgttccgagggcctatactataaataaaagatacagggaagaattt
cctgaagaatttgcagccttaaaacctaagagggtatttccttttatattttaa

DBGET integrated database retrieval system