KEGG   Torulaspora delbrueckii: TDEL_0A00520Help
Entry
TDEL_0A00520      CDS       T02236                                 

Gene name
TDEL0A00520
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
tdl  Torulaspora delbrueckii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TDEL_0A00520 (TDEL0A00520)
   03420 Nucleotide excision repair
    TDEL_0A00520 (TDEL0A00520)
   03430 Mismatch repair
    TDEL_0A00520 (TDEL0A00520)
   03440 Homologous recombination
    TDEL_0A00520 (TDEL0A00520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(89407..89413,89487..90331)
Genome map
AA seq 283 aa AA seqDB search
MATYQPYNEYSSVGGGDGGGFETTDQRPNSSESGGAQGRFTTLTPVTIKQILQSQQQVQD
GPFVIDQQELFHVSFVGVVRNIVDETSNVRLTIEDGTGQIDVKKWSADPNDVAASQDENL
KKNYSSQVAQQYHIGTYVKVFGALKEFGGKQHVQYALIKNIESFNEVITHHLEVIKWFTI
SNGKFSPSKANADEQATTSNNGPSLFVRESDSHDTGNPLQRVLAFCREQCAGKDPNNFAV
QVQLIAQSLNLDETTVRDCCTTLTEQGFIYPTINDSKFFALTS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctacttatcaaccatataacgaatattcgtccgttggaggaggtgatgggggtgga
ttcgagacaactgatcagagacccaattctagcgaatcgggtggggcacagggacgtttc
acgacactgactcccgttactattaagcagattttgcagtcacaacaacaggtgcaggat
ggaccatttgtgatagatcaacaggaattattccacgtttcgttcgtcggtgtcgtaagg
aatattgttgatgagacttctaatgttagattgactatagaagatgggaccggccagatt
gatgtcaagaaatggagtgcagatccaaacgacgtcgctgcgagccaggacgaaaatctc
aagaagaattatagttctcaagttgcgcaacagtaccatatcgggacctacgtaaaagtt
ttcggtgcattgaaggagtttggtgggaaacaacatgtacaatacgctttgatcaaaaat
attgagtccttcaacgaggtaataacgcatcatttggaagtcatcaaatggtttacaatt
tctaacggtaagttttcaccttcaaaggctaatgcagacgagcaggctactaccagtaac
aacggaccttcactattcgttagagaatcagattcccacgatacgggcaacccactacaa
agagtattggcgttctgtagagaacagtgtgcgggcaaagatccaaataattttgctgtt
caagtgcaactaatcgctcaatcgctgaacctcgatgagacgaccgtcagagattgttgc
acaactttgactgaacaaggctttatctatcctaccatcaatgacagcaaattcttcgcg
ttgacgtcttaa

DBGET integrated database retrieval system