KEGG   Torulaspora delbrueckii: TDEL_0A01620Help
Entry
TDEL_0A01620      CDS       T02236                                 

Gene name
TDEL0A01620
Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TDEL_0A01620 (TDEL0A01620)
Peptidases [BR:tdl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TDEL_0A01620 (TDEL0A01620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:291670..294057
Genome map
AA seq 795 aa AA seqDB search
MSGVNSHDSGEESYSMYPTTSSPPMPSQGSMHFPTYQPPVPIYAYPQVPYMYAGQTPGYP
FSMMNQGQMMYKGSGSGGMPQGSGVNTKKKWNNNGNGSRSNGGISSTKTHNYHHHQGSAT
FHPSSSISSPVGGSPASNLVNLSSRTDQYKFDVSKLSDTATSTTDLLLSPFFNTTEDEYV
VASGKRHELRVKSFPGLYQQNEEIKEESIKDEPKKEPLKSPAVSKSSSPTPEVTPLLTGA
STPSNTTPAPPFTDSETPSATLKTTPKSWSAIASGGIAKGKSSVSGSARSGSLSNVNHTS
SAQPPQKKDKKYIPPSTKGIEPLGSVALRMCYDPDFIDYTLKNPVLEKSLSIREVAPRGI
INRANICFMSSVMQVLLYCKPFINILNVVGTRNLNARAGTPECTLLDACVNFYKQFDKER
LESERKPQLKSKQQQTVNSVASIADAIKPDDFYSALSKIPKFKDLKWGHQEDAEEFLTHL
LDQLHEEFISFIDCLTDNEISNLLQSINDEELKIILHQKSTKIQECRIYKNPSASLKELI
IKYGSINDDDNEDGNGWHEVSGTSKKGKKNKTAAKRTVEVEPSPMSCLFGGQFRSVLDIP
NNKESQSITLDPFQTIQLDISERSVNDLETAFKKFSEYELLPFKSSSGNDVEAKKQTFID
KLPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMIPIESISSTNA
LRDEDRQYSLSGVIYHHGLSSDGGHYTADVYHKETDKWYRIDDINITEVQKDSVLKGGED
GVDSRTAYILMYQKK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtgtcaattcacatgatagtggggaagaatcgtactcaatgtacccgacgact
tcatcgcctccaatgccctctcagggtagtatgcatttcccaacgtaccagcctcccgtt
ccaatttatgcgtaccctcaggtaccttatatgtatgctggtcagactcctggttaccct
tttagtatgatgaatcaaggtcaaatgatgtacaaaggtagcggtagtggaggtatgccg
caaggttctggtgtgaacacgaagaagaaatggaataataatgggaatggtagtcggagt
aatggtgggatctcctcaacaaagacacataattatcatcatcatcaggggagtgcaaca
tttcaccccagctcatccatctcttcgccagtaggtggatctccagcaagtaacctggta
aatttgtcttctcgtactgaccagtacaagtttgatgtatccaagttaagtgatacagcg
acttcgacaaccgatttgctactttccccttttttcaacaccacagaggatgaatacgtg
gtggctagtggaaagagacatgaactcagagtgaagagttttccaggcttgtatcagcaa
aatgaagagataaaagaagaaagcatcaaagatgaacctaagaaagaaccattgaagagc
cccgcagtgtctaaatcttcttctcctacgccagaggtgacacctttgttaacaggagct
tctactccttccaatacaactccagcgccaccattcacagactctgagactccgtcagca
acattgaagactactccaaaatcctggtcagccatcgcatctggaggcatcgcaaagggt
aaatcatccgttagtggatctgctagatcaggatcattatcaaatgtgaatcataccagc
tccgcacagcctcctcaaaaaaaggacaagaaatacatccctccatcaactaaaggtatt
gaaccattgggatctgtcgccttgagaatgtgttacgatcctgacttcatcgattatact
ttgaagaacccagttttagagaaatctttgtccattagagaagtcgctccaagagggatc
ataaacagagctaacatatgttttatgagctctgtcatgcaagttctactctactgtaaa
ccctttattaatatcctgaatgttgttggtaccagaaacctgaacgcaagagctggcacc
cctgaatgtaccctgctagatgcatgtgtcaacttctacaagcaattcgataaggagaga
cttgaaagcgagagaaaacctcaactaaagagtaaacagcagcaaacagtaaacagtgtt
gcatctatcgctgatgcaatcaagccagacgatttttacagtgctctatcgaagattcca
aaattcaaggatttaaaatggggacatcaagaagatgcagaagagtttttaacccacttg
cttgaccaattacatgaggaatttatctctttcatcgattgtctaaccgacaacgagatt
tccaacttgctacaaagtatcaatgacgaagaattgaaaataattcttcatcagaaatct
acaaagatacaagaatgccgaatttataaaaatccgtcagcttcgttgaaagaattgatc
atcaagtatggaagtatcaatgacgacgacaacgaagatggtaacggctggcatgaagta
agtgggactagcaaaaagggcaagaagaacaagacagctgctaaaagaacagtggaagtg
gagccatcaccaatgtcctgcctatttggtgggcagttccgttcggtcttagatatccct
aacaacaaagaatcacaatcaatcaccctcgatcctttccaaaccatccagctggatatc
tccgagagatctgtcaatgacctggaaacggccttcaagaaattcagtgaatatgaactt
ctaccgtttaagtcatcttcgggcaacgatgtggaagctaagaaacaaactttcatcgat
aaattacctcaagtgttgttgattcagctcaagagatttcaatttatcaacaacacggac
aaagataacagcatgatcaactacaacgcatataacggccgcattgagaaaattcgcaaa
aagatcaattacgaacatgaacttatgataccaatagaatccatatcaagcacaaacgcg
ctcagagatgaggacagacaatacagtttgtcaggtgtaatatatcaccacggtttgagt
tccgatggcggccattatacagctgatgtttaccacaaggagacagacaaatggtatagg
atagacgatatcaacattacagaggtacagaaagacagtgtgttgaagggaggcgaagat
ggtgttgactcaagaacggcatatatattgatgtaccaaaagaagtaa

DBGET integrated database retrieval system