KEGG   Torulaspora delbrueckii: TDEL_0A01840Help
Entry
TDEL_0A01840      CDS       T02236                                 

Gene name
TDEL0A01840
Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TDEL_0A01840 (TDEL0A01840)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:336280..337209
Genome map
AA seq 309 aa AA seqDB search
MDDDNKDDDLYGILNERNIKEVQFGIDKRFPTWYGSNAYFSPDTNRLGYEEDFHTPVKND
VKTQYWLDTLYICEYCFKYTDVEADFVSHIPHCKYQFHAPGRIKYKSPSYTIRRVKGSRH
RLFCQCLCLFTKLFLDNKSMYFKVDHYEFYVVYRTGEFKPMAFFSKDLVSYHQNNLACIL
TFPPYQRLRLGTLLLEFSYKLSTFDNLISGPELPLSPFGLISYLKYWSKVICWELVEGEL
ANCEKLTIETIAKVTGIRIPDIILTMEYLKCLGNTHEIHLSVLRRRLKEFEHKSKELFLL
KDEYLLLED
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggacgatgataacaaagatgacgacctttacggtattctgaatgaaagaaatatcaaa
gaagtgcagtttggcattgacaaacgttttcccacttggtatggaagtaatgcatatttc
agtccggataccaatcgtttgggctatgaagaagactttcatactcctgtcaaaaatgac
gtgaaaacacagtactggctcgatacactatacatttgcgaatattgcttcaaatacaca
gatgtggaagctgattttgtctcacacattcctcattgtaagtaccagtttcacgctcct
ggaagaattaagtataaaagtccttcttataccataaggcgtgtgaaaggttctagacac
cgcttgttctgtcaatgcctttgtctatttacaaagctgtttctagacaacaaatcgatg
tattttaaagtggatcattacgagttttacgtcgtttataggactggtgaattcaaaccg
atggcatttttctccaaggacttggtatcatatcatcaaaataaccttgcatgcatattg
acctttccgccctaccagagacttcgattaggaaccctattactcgaattttcttataaa
ttatcgacatttgataacttaatctctggaccagaactgccactttcacctttcggtctt
atcagttatttgaaatactggtctaaagtgatctgttgggaactggtggaaggcgaactg
gccaactgcgagaaactcacaattgagactattgccaaagtaacaggaattagaataccc
gatataatactcacaatggaatacctgaaatgccttggtaatacacatgaaatacacctt
tctgttttgcgaaggcggttaaaggagtttgagcataagagcaaggaactttttcttttg
aaagatgagtatttactgctagaagactag

DBGET integrated database retrieval system