KEGG   Torulaspora delbrueckii: TDEL_0A02320Help
Entry
TDEL_0A02320      CDS       T02236                                 

Gene name
TDEL0A02320
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tdl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(419106..419999)
Genome map
AA seq 297 aa AA seqDB search
MSVTTDGSKVVLTHPDDKTSCVTILNYGATVTSWKLKGQEQLWLSEAAKLDGSKPVRGGI
PLVFPIFGKSKTDDALGKLPQHGLARNSTWEFLGQTKSNPPTVQFALSPEIANQELTKLW
PSDFSLVLTIELGLDFLKTAIEVNNPSKTEELKFNWLFHTYLKIEDIEDTFVSNLVGMKL
YDQLLQETYVDKHPVVTFHEEKDLVYKNIADERVIQVVRRGEPVHTLKRHNLPDAVVWNP
WINKSKSMADFEPKTGYEKMLCVEPGHVHDLITLAPGESWDAYQLLYRDELKYQAIE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttacaacagatggaagcaaggtggtattaacccacccagacgacaagaccagc
tgtgtgactattttgaactatggtgcaactgtgactagctggaaattaaagggacaagaa
cagctatggttatcagaggcagcaaaattggatggttccaagcctgttagaggtggtatc
ccgcttgtcttcccgatctttggtaagagtaagacagatgatgcattgggtaaattacct
caacatggtctggctagaaactctacctgggaatttttgggccagacaaagagcaaccca
cctactgtgcaatttgcattgagccctgaaattgctaatcaagagttaaccaaactatgg
ccatccgatttctctctagttttgaccatcgagttaggtcttgatttcttaaagacagct
atcgaggtgaacaacccatccaagaccgaagaattgaaattcaactggctgtttcacact
tatttgaagatcgaggatatcgaggatacttttgtctccaatttagttggtatgaagcta
tatgatcaattgctacaagagacgtatgtcgataaacaccctgttgtcacgttccatgaa
gagaaggatctcgtttacaaaaacatcgccgatgagcgtgtgatccaagtggttcgtaga
ggtgaacctgttcacactctcaagcgacacaacttgccagatgccgtcgtctggaaccca
tggattaacaaatccaaatcgatggcagattttgaaccaaaaaccggctacgagaaaatg
ctttgtgtggaaccaggccatgttcatgatcttatcactctggccccaggcgaatcatgg
gatgcttaccaattactgtacagagatgagttgaaatatcaagcgatcgaataa

DBGET integrated database retrieval system