KEGG   Torulaspora delbrueckii: TDEL_0A02770Help
Entry
TDEL_0A02770      CDS       T02236                                 

Gene name
TDEL0A02770
Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
tdl  Torulaspora delbrueckii
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TDEL_0A02770 (TDEL0A02770)
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     TDEL_0A02770 (TDEL0A02770)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(502295..503608)
Genome map
AA seq 437 aa AA seqDB search
MSAPPPLKPMTSANRLTVKTRSRRTSSVGKIDLGDTVPGIGTMSETRESRDDSNKRMKAL
AEAKENDMALLQKFWLTYRELSYRHAWLTPLMIMAIVYTAYFTSGNRTEKNPLHMFVAVS
YRIRDTDMYGKGIKDLCFVFFYMIFFTFLREFLMECVIRPITIALGVTSHHKVKRMMEQV
YAIIYYGFSGPAGLYIMYHSDLWLFKTAPMYRTYPDLLNHYHFKVFYLAQAAFWAQQACV
LVLQLEKPRKDYKELVFHHIITLLLIWSSYVFHFTKIGLEIYITMDVSDFFLSLSKTCNY
LDSALTAPVFMTFVASWVYLRHYVNLRILWSVLTEFRTEGNYVLNFATQQYKCWISLPIV
FVLIAALQLVNLYWLGCIGRILYRLLWKGIQKDERSDSESDDEEEVDNEQKNSKPITETD
NINIQDIPRDVKHEKAH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaccaccacctttgaaaccaatgacgtcagcgaaccgattgacagtcaagaca
agaagtaggcggacatcatccgttggcaagatcgaccttggtgacactgtacccggtatc
gggaccatgagtgaaaccagagagtcaagagatgattccaacaagcgtatgaaggcttta
gcggaggcaaaggaaaatgatatggcgctcttacaaaaattctggcttacctatagagaa
ttgagctatcgtcatgcctggttgacacccctcatgatcatggccattgtttacacggca
tacttcacttcaggtaacaggacagaaaagaatcctttgcatatgttcgtggccgtttct
tatagaattcgtgatactgacatgtacggtaaaggtatcaaggatctctgtttcgttttc
ttttacatgatctttttcacgttcctgcgtgaattcctcatggaatgtgtcattcgtcca
ataaccattgcgcttggcgtcacctctcaccataaagtcaagagaatgatggaacaggtc
tatgcaattatctattatgggttttcaggtcccgcaggactttacatcatgtatcattcg
gatttgtggcttttcaagaccgctccgatgtacagaacttatccagatctattaaatcat
taccacttcaaagtcttttatttggcgcaggcagcgttttgggctcaacaggcttgtgtt
ctcgttctgcaactggagaaaccaagaaaagattacaaagaactagtttttcatcacatc
attactttgttattgatttggtcctcttacgttttccatttcacaaaaattggtttagaa
atctatattaccatggacgtttctgatttctttttgtctttgtcaaagacttgcaactat
ttggattctgctttaacagcgccggtcttcatgacttttgttgctagttgggtttatttg
cgtcactacgtcaaccttagaatcctttggtcagttctgactgagttccgtactgaaggc
aattatgttttaaattttgccacacagcaatacaaatgttggatttcgctgccaatcgtt
tttgtcttgatcgcagctctgcaattggttaatctatattggcttggatgcatcggaagg
attctatacagattactatggaaaggaattcagaaggatgaaagaagtgatagtgaatcg
gatgatgaagaagaagttgacaacgagcaaaagaacagcaaaccaatcactgagactgac
aacatcaacatacaagatataccaagggatgtaaagcacgagaaggcacactga

DBGET integrated database retrieval system