KEGG   Torulaspora delbrueckii: TDEL_0A04190Help
Entry
TDEL_0A04190      CDS       T02236                                 

Gene name
TDEL0A04190
Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
tdl  Torulaspora delbrueckii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    TDEL_0A04190 (TDEL0A04190)
Enzymes [BR:tdl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     TDEL_0A04190 (TDEL0A04190)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:743879..745591
Genome map
AA seq 570 aa AA seqDB search
MSVTQKDISGEESSTLYSSPKTTQSDGYSADVAESRLQDTNNGVQQQLKGTRKGRSRALQ
GLLEEACKYHSQYEYTLPRGFLRNRSQPGKSSQELEEDESIDEKVARPKSTRKRSESVKR
NSPSAAGRRKQRSTRSKSTSPSSDSPVPTKIQNENAFEAAGNNGVRHISKNQEVTFVKQD
QELFNIPYDMIDIEYLEQNETYKDHPLPSAFLTAKRHQNDISVLTVALKSPLFSNYSEEY
HIDFSKDSRIYNPMSELGKLIEYSAIIFLPAAYADTVKKTIIPGLNKAFDTSNDEEFAEV
INNYNKILKQVPRGEVIKHLAQRKNVPRSFFHDFLHIVYTRSIHPNFRKLKEYEAFSNYV
YGELLPSFLSEVYSQCGMNSESVFMDLGSGVGNCVVQAALEYGCKLSFGCEIMPNASALT
ELQHEELVKRCNLFGLKLHPVEFSLRRSFVDNRRVDELVPQCDIILVNNFLFDNTMNQKV
EGILQKVKTGCKIITLKNLRPFGYTINFENVDSILNRLHVERFELKENSVSWTHRGGEYF
ISTVLPDMDESLFDPSMRKRNIKRPAHYTR
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaactcaaaaagatatatctggggaggaatcctcaacgttatattcatcacca
aagaccacacaatcggacgggtattctgcagatgtggcagaatccaggctacaggatacc
aacaacggggttcaacagcagttgaaagggactaggaagggaagaagtcgtgctttgcaa
ggattgcttgaggaagcatgtaagtatcactcacagtatgaatacactttgcccagaggg
ttcctaaggaacaggagccaacctggaaaatcatcacaggaacttgaggaggatgagtct
attgatgagaaagtcgcaagaccgaaaagtactaggaaacggtcagaatcggtcaagaga
aacagtccctcagctgctggaaggagaaaacaaaggagtacaagaagtaagtcaactagc
ccctcgagtgattctcccgtacctacgaaaattcagaatgagaacgccttcgaggcagca
ggtaataatggcgtacgtcacatctctaagaaccaggaagtaacttttgtcaagcaagat
caggaactctttaatattccttacgatatgattgacattgaatacttggagcaaaatgag
acatacaaagatcatccactgccctctgcatttttgactgctaagagacatcagaatgat
ataagcgtcctaacagtggcattgaaatctcctttgttctcaaattactctgaggaatac
catatagacttttcgaaagatagtcgaatttacaacccaatgagcgagttgggcaagttg
attgaatattcggcaatcattttcctaccagcagcttatgctgatacagtgaaaaaaacc
atcatccccggtttaaacaaggcatttgatacttcaaatgacgaagagtttgccgaggtc
attaacaattacaataaaatactcaagcaagtaccgcgaggtgaagtgattaaacacttg
gcacaacgaaagaacgttcctcgttctttttttcatgattttctacacattgtctacaca
agaagcatacaccccaactttagaaaactgaaggagtacgaagcattcagcaattatgtt
tatggggaattgctgccttcatttttatcagaagtttactcgcaatgcggtatgaactct
gaatcggtcttcatggatctcggatccggtgtgggtaactgtgtggttcaagctgcatta
gaatacggttgcaagttaagttttggctgtgaaatcatgccaaatgcgagtgctttgacc
gaactacaacatgaagagcttgttaaacggtgcaacttattcggtttgaaactacatccc
gtggaattctccttgaggagaagctttgttgataatagacgagtggatgaactggtacca
cagtgcgacattatccttgtgaataattttcttttcgataatactatgaaccagaaggtt
gaaggcattctacaaaaggtgaaaacaggctgcaaaatcataacgttaaagaacttaagg
cctttcggatacacgataaatttcgaaaacgtcgacagcatattgaacagactacacgtt
gaaaggttcgaattgaaagagaatagcgtttcttggactcatagaggtggtgaatatttc
atttcaactgttcttcctgacatggacgaatctctattcgatccaagcatgcgaaaacgg
aacatcaagagacctgctcattatactcgctga

DBGET integrated database retrieval system