KEGG   Torulaspora delbrueckii: TDEL_0A04230Help
Entry
TDEL_0A04230      CDS       T02236                                 

Gene name
TDEL0A04230
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TDEL_0A04230 (TDEL0A04230)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TDEL_0A04230 (TDEL0A04230)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TDEL_0A04230 (TDEL0A04230)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(752422..752907)
Genome map
AA seq 161 aa AA seqDB search
MSEFYKLSPKDKKGEPFPFSQLEGKVVLIVNVASKCGFTPQYEELEALYKKYKDQGLVVL
GFPCNQFGSQEPGSDEEIGQFCQLNYGVSFPVLKKVDVNGGNADPVYEYLKSQKSGLLGF
RGIKWNFEKFLVDKKGVVQQRYSSLTKPSSLDSAIADLLKA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattctacaaattgagtccaaaggacaagaaaggtgagccatttccgttctct
cagttggagggcaaggtggtcttgatcgtcaacgttgcatcgaaatgtggattcactcca
caatatgaggaattggaggctctttacaaaaaatacaaggaccagggtctagtcgttctt
ggattcccttgcaaccagtttgggagccaggaacctggcagtgatgaggaaattggccag
ttctgtcagttgaactacggtgtcagtttccctgtgttgaagaaagttgatgtgaatggt
gggaatgcagaccctgtctacgaatatctaaagtctcaaaagtcaggcttgctaggtttc
agaggtatcaaatggaactttgagaaattcttggttgataagaagggtgttgttcagcaa
agatactcatctttgaccaagccgtcttcgttggactccgcgattgccgatttgctcaag
gcttaa

DBGET integrated database retrieval system