KEGG   Torulaspora delbrueckii: TDEL_0A04230Help
Entry
TDEL_0A04230      CDS       T02236                                 

Gene name
TDEL0A04230
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tdl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tdl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(752422..752907)
Genome map
AA seq 161 aa AA seqDB search
MSEFYKLSPKDKKGEPFPFSQLEGKVVLIVNVASKCGFTPQYEELEALYKKYKDQGLVVL
GFPCNQFGSQEPGSDEEIGQFCQLNYGVSFPVLKKVDVNGGNADPVYEYLKSQKSGLLGF
RGIKWNFEKFLVDKKGVVQQRYSSLTKPSSLDSAIADLLKA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattctacaaattgagtccaaaggacaagaaaggtgagccatttccgttctct
cagttggagggcaaggtggtcttgatcgtcaacgttgcatcgaaatgtggattcactcca
caatatgaggaattggaggctctttacaaaaaatacaaggaccagggtctagtcgttctt
ggattcccttgcaaccagtttgggagccaggaacctggcagtgatgaggaaattggccag
ttctgtcagttgaactacggtgtcagtttccctgtgttgaagaaagttgatgtgaatggt
gggaatgcagaccctgtctacgaatatctaaagtctcaaaagtcaggcttgctaggtttc
agaggtatcaaatggaactttgagaaattcttggttgataagaagggtgttgttcagcaa
agatactcatctttgaccaagccgtcttcgttggactccgcgattgccgatttgctcaag
gcttaa

DBGET integrated database retrieval system