KEGG   Torulaspora delbrueckii: TDEL_0A04370Help
Entry
TDEL_0A04370      CDS       T02236                                 

Gene name
TDEL0A04370
Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tdl  Torulaspora delbrueckii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TDEL_0A04370 (TDEL0A04370)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TDEL_0A04370 (TDEL0A04370)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(773339..773902)
Genome map
AA seq 187 aa AA seqDB search
MPRPIVLSGPSGTGKSTLLKKLFAEFPNKFGFSVSSTTRSPRAGEVDGKDYNFVPVEEFK
RMISADEFVEWAQFSGNYYGTTVASVKKVADSGRTCILDIDMQGVKSVKYKTDLDARFLF
VAPPSVADLEKRLRGRGTETEESIAKRLAAAKAEIEYAETGAHDQILVNDDLQRAYNELK
EFIAQEE
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctatcgttttgtctggccccagtgggactggtaagtccactttgctcaag
aaattgttcgccgagtttcccaacaagtttggtttcagcgtttcttcaaccactcgttct
ccaagagctggtgaggttgatggtaaggactacaactttgttccagtcgaggagttcaaa
aggatgatttctgcagacgagtttgtcgaatgggctcaattttcaggcaattattatggg
accacagttgcttctgtcaagaaagtcgccgactctggtagaacttgtatcttggacatc
gatatgcaaggtgttaagtctgtcaagtacaagaccgacctagacgcaagatttctgttt
gtagctccaccttcagtggcagatttggagaaaagacttagaggtagaggtactgagacc
gaagaatccattgccaagagacttgcagcagccaaggctgaaatcgagtacgcagaaaca
ggcgcccacgaccaaatattggtcaatgacgacctccagagagcctacaacgagctcaag
gagttcattgcccaggaagagtga

DBGET integrated database retrieval system