KEGG   Torulaspora delbrueckii: TDEL_0A05070Help
Entry
TDEL_0A05070      CDS       T02236                                 

Gene name
TDEL0A05070
Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TDEL_0A05070 (TDEL0A05070)
Transfer RNA biogenesis [BR:tdl03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TDEL_0A05070 (TDEL0A05070)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:900737..902422
Genome map
AA seq 561 aa AA seqDB search
MGRSGKGPKNNKQNLAPEKERFIQCCADITLELTSSLTSGTTREINLNGLITKYSKKYKL
RQQPRLTDIINAIPDQYKKYLLPKLKAKPVRTASGIAVIAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQLKQLGHSIDKVEYIIMG
GTFMSLPKDYREDFIVKLHNALSGFNGNDIDEAIQYSQQSLTKCVGITIETRPDYCTQTH
LDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVKSVCETFSVAKDAGYKVVSHMMPDLPN
VGMERDIEQFKEYFENPAFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYNANALVDLVAR
IMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTKCRDVRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKNNTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIALEEHGSEKISVISGVGVRTY
YGKLGYELDGPYMSKKLVASF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcagtggaaaaggccccaagaacaacaagcaaaatctcgctccagagaaggaa
agattcattcaatgttgtgccgatattactttggaactaacaagttctttgacatctggg
accaccagagaaattaacttgaatggtcttatcactaaatattctaaaaaatacaagttg
agacaacaaccgaggctgactgatattattaatgcaatcccagaccaatataagaagtat
cttttaccaaaactaaaggccaagcctgtgagaacagcttcgggtatcgctgttattgcc
gttatgtgtaaaccacatcgttgcccccatattgcatataccggtaatatctgtgtatac
tgtcccggtgggcctgattccgatttcgaatactctacacagtcctatactggttacgag
cccacctctatgcgtgccattagagcccgttatgacccttacgagcaagcgcgtggtaga
attgaacaattgaaacaattgggtcattctatcgacaaagtcgagtatatcattatgggt
ggtactttcatgtctttacctaaggattaccgagaagatttcattgtcaaacttcataac
gctttgtccggttttaatggtaatgatatcgatgaggcaattcaatattcgcaacaaagt
ttaactaaatgtgttggtataaccatcgagaccaggccggattactgtactcagacacat
ttggacgatatgttgaaatacggctgtacaagactggagatcggtgtgcaatctttatat
gaagatgttgcccgtgataccaacagaggtcataccgtaaagtccgtatgtgagactttt
agcgtcgctaaggatgctggttacaaagttgtctctcatatgatgcctgatttgcccaat
gtaggcatggagagagacattgaacaatttaaagaatatttcgaaaatccagctttcagg
acagatgggttgaagatctacccaacattagtcattagaggtactggtttatacgaactt
tggaagacaggaaggtataagtcatacaacgccaacgcgcttgtggatttggttgcaaga
atcatggcactggtcccaccatggacaagaatttatcgtgtgcaaagagatattccaatg
cctttggtcacttctggtgtggataatggtaatttaagagagttggcattggccaggatg
aaagacttcggtaccaagtgtcgagacgtacggaccagggaagttggtattcaggaagtc
catcacaaggtacaacctgatcaagtagagcttatcaggagggattactatgcgaacggc
ggttgggagactttcttatcatacgaagacccaaagaaagatatcttgattggtttgtta
agactaagaaaggcttcaaaaaataacacatacagaaaagagttcacgtctcaacgtaca
tcgatcgtgagagagcttcacgtttacggttctgtcgtaccattgcattcgagagaccca
cgtaaattccagcatcaagggtttggtactttattgatggaggaagcagagaggatagca
ctcgaagagcacggttcagaaaagatttctgtcatttcaggtgttggtgttagaacatac
tatggcaaattgggttatgaattagacggtccatatatgtcaaagaaattagtcgcctct
ttttaa

DBGET integrated database retrieval system