KEGG   Torulaspora delbrueckii: TDEL_0A05460Help
Entry
TDEL_0A05460      CDS       T02236                                 

Gene name
TDEL0A05460
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TDEL_0A05460 (TDEL0A05460)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TDEL_0A05460 (TDEL0A05460)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TDEL_0A05460 (TDEL0A05460)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(957597..958571)
Genome map
AA seq 324 aa AA seqDB search
MDAEQAPTYNYFKNKELALVLAPFAGGQGHVGVENGPKYMLQHGLESQLQELGWKTTIER
PLDNESIVKKMLQDTSKDAYGHIKRPNLVGEATELIYKTVKKSLQEGKFPLTLGGDHSIA
IGTVSGVLDKFPDAGLLWIDAHADINTLESTESGNLHGCPVSFLMGLDKDNECPEALKWV
PGNLRPEKIAYIGLRDIDAGEKKILRELGIKAFSMYHVDRYGINNVIEMALKAINPDGKG
PVMCSYDVDAVDPLFVPATGTPVRGGLTLREALFLSERLAETGDLVALDVVECNPALATH
DLHIVDTISAGCAIARCALGETLI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgaacaagccccaacatacaattacttcaaaaacaaagaattagcattggtg
cttgcaccttttgctggtggccagggccatgtcggtgttgaaaatggaccaaaatatatg
ttacaacatggtttggaatctcaactgcaagagctcggttggaaaactactattgaacgt
ccacttgacaacgaatccatcgtgaaaaaaatgctccaggatacttccaaggatgcatat
ggtcatattaaacgtcctaacctggttggagaagccactgaacttatttacaagacagtg
aagaaaagtctacaagagggaaagttcccattgacacttggaggagatcactctatcgcc
attggtacagtttcgggagtattggacaaatttccagacgctggactgctttggatcgat
gcacacgcagatattaacacattagagtctacagaatcaggaaaccttcacggttgccct
gtatcattcctaatgggtcttgacaaggacaatgaatgccctgaagcactcaaatgggtt
ccaggtaacttaagaccggaaaagattgcatatattggactcagagatatcgatgcgggt
gaaaagaagatcctacgtgaactcggcattaaagctttctccatgtaccacgttgaccgt
tacggaatcaataacgttattgaaatggctttgaaagctattaaccctgatggtaaggga
ccagtaatgtgctcttacgatgtcgacgcagtcgacccactgttcgttccagctaccggg
accccagtaagaggaggactaactctaagagaagcattgtttctgtccgagagactagca
gaaacaggagacctggtagcactcgacgtagtcgagtgcaatcctgccttggcaactcat
gatctacatattgttgatacaatctcagccggctgtgccatcgccagatgtgcgctgggt
gaaacactaatctaa

DBGET integrated database retrieval system