KEGG   Torulaspora delbrueckii: TDEL_0A05520Help
Entry
TDEL_0A05520      CDS       T02236                                 

Gene name
TDEL0A05520
Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TDEL_0A05520 (TDEL0A05520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(970572..972596)
Genome map
AA seq 674 aa AA seqDB search
MAEEDPLSKFYKQFQVFVQNNPNVISAARAASQIPESAKAVIVLSPYSLQHAFPRDWVSK
SYRKTIVERPERLLAGSMGISAAVTMYPALFTLKSSNQRKGSLVSPHVLKVHGRDWPPTL
LRLCKHADEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGALETGVDSIFEGPSPEHV
SNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTYGITHAVVLDFDLHHGDGTQD
ICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDINSFPTESGYATKDNIKSAS
TCIMNGHDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKADEFFKNAKIEMSAKGKKFKG
LVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQMHSEGKVLSVLEGGYSDK
AITSGVFAHLIGLQNQNWIKEWGSEQVVKEIVRGCKPNWKPYKSKKTRDVIRIWAEEVIK
LGRAMIPEFEQVLFAETKADSVPETQKESLRSTTIAQRLTRSQGQQLPSEPKEVTPPRRI
INSKASESAPAVPFAQQEIATDDENDDEDYVYDEELNRTFNRTVEDITIDDISRHLETLE
IIETPSTTEPKKPVQHKVETKATLGKYKIPTSTTTQHLRSHRYSGAPDYDDSDVSMVSHI
STAKKHTTRSGRKW
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaggacccattgagcaagttctacaagcagtttcaggtgtttgtacagaac
aacccgaatgtgatatctgctgctagagcggcttcgcagatcccagagtctgcgaaagct
gttatcgtactgtcaccttactcgttgcaacatgcatttcccagagattgggtgagtaaa
tcctatcggaagactattgtcgaaaggccagagaggttgctagctggatctatgggtata
tcagctgcagtgaccatgtatcccgcattattcactttaaaatcttctaatcagcgtaag
ggatcgttagtatcacctcatgttttgaaagttcatggaagagattggcctccaacgttg
ctaagactttgtaagcatgcggatgagaaattggctaaaggtgagatagaagtgcccgat
tcgtggaactcaggggatatctacttgagttcaaagaccattgaggctctacaagggtct
attggagccttagagactggtgtggactctatttttgaaggtccttcgcctgaacatgtg
agtaatcgtgcttttgtcgtgatacgaccacctggtcaccattgtagggctggcacgcct
tcaggcttctgtttactgaacaacgctcatgtttcaatcgagtacgcccacgatacctac
ggtataacccatgccgtggtgctggatttcgacttgcatcatggcgatggtactcaggat
atatgttggaaaagagcaggatttagacccgatgaacaggatgaaaatactggtggctac
gatgagtttggtaagaaattcgccgaatttccacgagttggctacttttcaatgcatgat
atcaattcattcccgacagaatcgggatacgctaccaaagacaatatcaaaagtgcatcg
acgtgtataatgaacggacatgatttgaatatttggaatgtacatttatctgcctgggaa
acagaagaagatttcaacaagctgtaccaatctaaatacagaacgttatttgctaaggca
gatgaattcttcaagaatgccaagatagagatgagtgccaagggtaagaagtttaaggga
cttgttgtaataagtgcaggattcgatgcttccgagttcgagcaagtgagtatgcaaaga
catggagtcaatgtgcccactaatttctacacgatgttcaccaaggatgcattgaagcta
gctcaaatgcactcagagggtaaagtgctttcagtgctagaaggtggctactctgataaa
gccataacctctggggtatttgcgcacttgatcggactacagaatcaaaactggataaaa
gaatgggggtctgagcaagtggtcaaagagatagtacgcggttgtaagcctaattggaaa
ccttacaagtccaaaaagactcgagatgtgataaggatctgggcagaagaagtgatcaag
ctcggaagagcaatgatcccagaattcgaacaagtactgtttgcagaaacaaaagcagac
tctgtgccagaaacacaaaaggagagtttacgtagtacaacaatcgcacaaagactgacc
agatcccagggacaacaactaccgtcagaacctaaggaagtcacacctccgcgtcgtata
ataaacagtaaagcatcggaatcggccccagcagtaccgtttgcccaacaagagattgca
actgatgacgaaaacgacgacgaggactatgtctacgacgaagaacttaacagaacattc
aaccgtaccgtcgaagatattaccatcgacgatatctctcgccatctggaaactctcgaa
ataattgaaactccatctaccacggagcccaagaaaccagtacagcacaaggtagaaacc
aaagccacgttgggcaagtacaagatcccaacaagtaccacaacgcaacatttgagatcc
catcgctactccggcgcccccgactacgacgacagtgacgtctccatggtctcccatatc
tcaacggccaagaagcacaccaccaggagcggtcgcaagtggtga

DBGET integrated database retrieval system