KEGG   Torulaspora delbrueckii: TDEL_0A05660Help
Entry
TDEL_0A05660      CDS       T02236                                 

Gene name
TDEL0A05660
Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tdl  Torulaspora delbrueckii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TDEL_0A05660 (TDEL0A05660)
  Replication and repair
   03420 Nucleotide excision repair
    TDEL_0A05660 (TDEL0A05660)
Transcription machinery [BR:tdl03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TDEL_0A05660 (TDEL0A05660)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:996131..997672
Genome map
AA seq 513 aa AA seqDB search
MSNSNLLKSSVNQYLEELPQQIQSRLYQSPATCLAIYRLLPQMAKFFIMSMVFNENEISL
RDLDRWVKASGKNQFQDAIKSMKSLHLLIPVRTNGPMMINLNQTFRESFRNALTGGEVNN
SFGIVVDEPNDVVNTEMLDAYSADKWETILHFMVGTSLASTPSGNVLNLLKHSKLMEEVS
TTGEFKITNEGFQFLLQEVNSQIWALLLQYLKMTETLQMDPVEVLNFIFMLGALEFGKPY
SMDGLSDTQKLMSKDMRDYGLVFQKNSNSKVFYPTRLATMLTSDAKSIRGASGAMDSVLK
QNKDEASNKAASSNADADSDDDEVGINGQPIQDGALIVETNFKLYSYSNSPLQIAILSLF
VHLKSRFTNMVTGQITRESIRRALINGITADQIIAYLQTHAHPQMRRLAEEKLEKKLELD
ANCKDTLQILPPTVVDQIKLWQLELDRIISYDGSLYSDIDSHQEYILLSTYAQDIGVLLW
KDDRKRIFFVSKEGNSQVLDYAKRKLKKKQSPP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatagtaacctactgaaaagttcagtgaatcaatatctcgaagagctccctcag
caaattcagagcagactctatcagtcgccagctacatgtttggccatttacaggttgctg
ccacaaatggccaaattctttatcatgtctatggtgttcaatgagaatgaaatatcccta
cgagatttggatagatgggtaaaagctagtggaaagaatcaattccaggatgcaatcaag
tccatgaaatcgcttcatttactgattccggtcaggaccaatggtcctatgatgatcaat
ttaaatcaaactttccgagagagtttcaggaatgcgcttactggtggtgaagttaacaac
tcatttgggattgttgtagatgaacctaatgatgtggttaatacagaaatgttagatgca
tattctgctgataaatgggaaacaatattgcatttcatggttggtacttctctcgcgagt
actccatcggggaatgtcctaaacctcttaaagcacagtaagctgatggaagaggttagc
actactggtgagtttaagataacaaacgaaggttttcaatttttactacaggaagttaac
tcccagatatgggccttactcttacagtatttgaagatgacagaaaccttacaaatggat
cccgtcgaagtactcaacttcatctttatgttaggtgcccttgaatttggtaaaccatac
agcatggacggtttaagtgatactcaaaaactaatgtcaaaagatatgagagactatggt
ttagtcttccagaaaaactctaattcaaaagtgttctatccaactagattagccaccatg
ttaacatcagacgccaagagcataagaggtgcctctggcgcgatggacagtgtcttaaag
cagaataaggacgaggcttcgaacaaagcagcgagctcaaatgctgatgcagatagcgat
gacgatgaagttggcatcaacggtcagcctatccaggatggcgctctcatagttgagacc
aatttcaaactctactcttattccaattccccactacagatcgctattttaagtctgttt
gtacatctgaaatctagatttaccaacatggttactggacaaatcacaagagaatctatc
agaagagctctaataaacggtatcaccgctgaccaaataatcgcctatctacaaactcat
gcgcatccacaaatgagacggctggctgaagaaaaactcgagaaaaaactcgagcttgat
gccaattgcaaagatacgctacaaattcttcctcctactgtcgtagaccaaataaaacta
tggcagctcgagctcgacagaattataagctacgacggttcattatattcagatatcgac
agccatcaagaatatatactactaagcacctacgctcaggatattggagtcttgctatgg
aaagatgataggaagaggatattcttcgtttcgaaggaaggtaattcgcaggttctggac
tacgcaaagagaaagttgaagaagaaacaaagcccgccttga

DBGET integrated database retrieval system