KEGG   Torulaspora delbrueckii: TDEL_0A05980Help
Entry
TDEL_0A05980      CDS       T02236                                 

Gene name
TDEL0A05980
Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
tdl  Torulaspora delbrueckii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:tdl04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1049221..1050771
Genome map
AA seq 516 aa AA seqDB search
MASLFRPPGASKRNTKSPKLTLPPLLRNNNTTPASTTDGSVDGRPMGLKNSEYTSSPRSS
SSEATLSSHSQQQPYSASSSSTLKTLKKRPVPPPLPPLTLTGEFRADSKPSSENPTSVSD
SFQRLQLNSENGHSGTISPSMRSSKVDSSISRPTTHSSVPEFPYLRKELNESIDSYPSTL
LSAYEQSSRDCSPIKKETQVNEHPMAGKDVDKLDEEMWEYPQLQDEIETLGILGEGAGGS
VAKCKLKHGSKIFALKTINTLNSDPEYQKQIFRELQFNKSFECDSIVKYYGMFTDKQNST
IYIAMEYMGGRSLDAVYKNLINRGGRISEKVLGKIAEAVLRGLSYLHERKIIHRDIKPQN
ILLNDKGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLE
VAQGCFPFGSDKMTANIAPIELLTLILTFTPELKDEPELNITWSGAFKSFIEYCLKKDAR
ERPSPRQMIRHPWVQGQMKKKVNMEKFIQKCWEEDS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctcttcagacctcctggggcttcaaaacgtaatacaaagtctcccaaattg
actctcccgcctttgttgaggaataacaatactactccggccagtacaacagatggcagt
gttgatggcaggcccatggggctgaagaattccgaatacacatcctcacctcgatcatca
tcttcagaagcaacactttcctctcatagtcaacagcagccttactccgcatcttcgtcg
agtacattgaagacattgaagaaacgtcctgtccctccaccgctaccgcctctgacactg
acgggcgaatttagagcggattctaaaccttcatcagagaatcctacctccgtttcagac
tcattccagaggttgcaattgaattctgagaatggtcatagtgggactatctctcctagc
atgagatcttcaaaggtagactcttctataagcagacccacaacacacagctctgtccca
gagtttccatatttgaggaaagaattaaatgagtcgatagattcatatccttcaacgtta
ctttcagcatatgaacaaagcagtcgcgactgtagcccgataaagaaggagactcaagtg
aatgagcatccaatggcaggcaaggatgtcgataaacttgacgaggaaatgtgggagtac
ccacaactacaagacgagatagaaactttggggatattaggagaaggtgctggtggctca
gtggccaaatgtaaattaaagcatggttccaagatttttgcactcaagacgatcaacacc
ctgaacagtgatcccgaataccaaaagcagatctttagagagttacaatttaataagagt
tttgagtgtgactccatcgtgaaatactatgggatgttcacagacaaacaaaatagcaca
atttacatcgcgatggaatacatgggaggtagatcattggatgcagtatacaaaaatctg
atcaatcgtggtggtagaataagtgaaaaagtactaggtaagattgcagaagctgtgctt
cgaggtttatcctacctacatgagagaaaaatcattcatcgggacattaaaccacaaaac
attctactcaacgacaagggccaggtgaaactgtgcgattttggtgttagcggtgaagca
gtcaattcgttggcgacaactttcacgggaacttccttctacatggcaccagagagaatc
cagggtcaaccttatagtgttacatgcgacgtctggtcactcgggctaacactactggaa
gttgcacaaggctgtttcccctttggatccgacaagatgacagctaatatcgcaccgatc
gagctattgacgttgatcctgacttttacaccggaactcaaagatgagccagaactcaac
ataacctggagtggggcattcaaatcgttcatcgaatactgtctgaagaaagacgctcgc
gagagaccatctccaaggcaaatgatacggcacccatgggttcaaggtcagatgaagaag
aaggttaacatggagaaattcatccagaaatgctgggaagaagattcttag

DBGET integrated database retrieval system