KEGG   Torulaspora delbrueckii: TDEL_0A06030Help
Entry
TDEL_0A06030      CDS       T02236                                 

Gene name
TDEL0A06030
Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tdl  Torulaspora delbrueckii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tdl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tdl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1057989..1058603
Genome map
AA seq 204 aa AA seqDB search
MSKVPVVAVVACMIPEMGIGFQGKLPWRLATEMKYFKEVTSTTKDPTKVNAVVMGRKTWE
SIPPRFRPLPNRINMVVSRQPRAQLHLDDQVYSTSSLSQGIEHLNTNFGERLERIYIIGG
AEIYSQSYELVDHWLVTKIQPLPESQVPEMDTHLDPQRLALTFKERSLDELSQFLPQTSV
PIVNPIEEKGFHYWFTLYTNQRAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtacccgtagtggccgtagtagcgtgtatgatccccgaaatgggaattggt
tttcaaggtaaattgccctggagattagccacagagatgaaatattttaaagaagttact
tcaacgacaaaggatcctacaaaggttaatgccgtcgttatgggacgaaagacatgggaa
tcaatacctccaaggttccgtccattaccaaaccgaattaacatggtcgtttcacgtcaa
ccaagagctcaattgcatctagatgatcaagtttacagtacatcttcgctatctcagggc
atcgaacacttgaacacaaatttcggtgaacgtctcgagcgcatatacatcattggtggt
gcagaaatttattcacaaagctacgagcttgtagatcactggctagttaccaagattcaa
ccacttcctgaatcgcaagtgcccgagatggacactcacttggaccctcaaagattggcg
ctaacctttaaagaacgctctctggatgaactgagccaatttctaccacagacttcagta
ccgatagtgaatcccattgaagagaagggtttccattactggttcaccctatacacaaat
caaagagctttatag

DBGET integrated database retrieval system