KEGG   Torulaspora delbrueckii: TDEL_0A06030Help
Entry
TDEL_0A06030      CDS       T02236                                 

Gene name
TDEL0A06030
Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tdl  Torulaspora delbrueckii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TDEL_0A06030 (TDEL0A06030)
   00670 One carbon pool by folate
    TDEL_0A06030 (TDEL0A06030)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TDEL_0A06030 (TDEL0A06030)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1057989..1058603
Genome map
AA seq 204 aa AA seqDB search
MSKVPVVAVVACMIPEMGIGFQGKLPWRLATEMKYFKEVTSTTKDPTKVNAVVMGRKTWE
SIPPRFRPLPNRINMVVSRQPRAQLHLDDQVYSTSSLSQGIEHLNTNFGERLERIYIIGG
AEIYSQSYELVDHWLVTKIQPLPESQVPEMDTHLDPQRLALTFKERSLDELSQFLPQTSV
PIVNPIEEKGFHYWFTLYTNQRAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtacccgtagtggccgtagtagcgtgtatgatccccgaaatgggaattggt
tttcaaggtaaattgccctggagattagccacagagatgaaatattttaaagaagttact
tcaacgacaaaggatcctacaaaggttaatgccgtcgttatgggacgaaagacatgggaa
tcaatacctccaaggttccgtccattaccaaaccgaattaacatggtcgtttcacgtcaa
ccaagagctcaattgcatctagatgatcaagtttacagtacatcttcgctatctcagggc
atcgaacacttgaacacaaatttcggtgaacgtctcgagcgcatatacatcattggtggt
gcagaaatttattcacaaagctacgagcttgtagatcactggctagttaccaagattcaa
ccacttcctgaatcgcaagtgcccgagatggacactcacttggaccctcaaagattggcg
ctaacctttaaagaacgctctctggatgaactgagccaatttctaccacagacttcagta
ccgatagtgaatcccattgaagagaagggtttccattactggttcaccctatacacaaat
caaagagctttatag

DBGET integrated database retrieval system