KEGG   Torulaspora delbrueckii: TDEL_0A06190Help
Entry
TDEL_0A06190      CDS       T02236                                 

Gene name
TDEL0A06190
Definition
(RefSeq) hypothetical protein
  KO
K11304  histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TDEL_0A06190 (TDEL0A06190)
Chromosome and associated proteins [BR:tdl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TDEL_0A06190 (TDEL0A06190)
   HAT complexes
    TIP60 complex
     TDEL_0A06190 (TDEL0A06190)
    NuA4 complex
     TDEL_0A06190 (TDEL0A06190)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_1 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 11503023
NCBI-ProteinID: XP_003679162
UniProt: G8ZMV7
Position
1:1083687..1085018
Genome map
AA seq 443 aa AA seqDB search
MSPDEEKKPGIPRKIQNVEEIIMKCECYVEKDGEERLAEILSINSRRSPPKFYVHYVDFN
KRLDEWITADRINLEKDVMFPRPKTAEEDINKQKKKKKKTPGPSTGESGDQRSESPEATD
VMDLEDLNVQGLQDEELSREDEIKKLRTSGSMTQNPHEVARVRNINRVIMGRFQIEPWYF
SPYPIELTDEDVVYIDDFTLQYFGSRKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGR
QQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNV
ACILTLPQYQRMGYGRLLIEFSYELSKQEGKVGSPEKPLSDLGLLSYRAYWADTLITILA
DHGREITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNDDIMKRYDQLFSKPRR
RITPSKLVWKPPIFTASQLRFAW
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagtcccgacgaggagaagaagccgggtataccaagaaagatccaaaatgtggaggaa
attattatgaaatgtgagtgttatgttgaaaaagatggcgaagaaagactggctgagata
ctgtcgattaattctagacgatctcctccaaaattttatgtccactacgtggacttcaat
aaacggctagatgaatggattacggcagaccgaataaatttggagaaggacgtcatgttt
ccgcgacctaagacagcagaagaggatatcaacaagcaaaagaagaagaagaagaagact
cccgggccttcaaccggagagtccggtgatcaacgttcagaatcaccggaggcgaccgat
gttatggacttggaagatttaaatgtgcagggattacaggatgaagagttatcgcgagaa
gatgaaatcaaaaaacttcggacttctggctccatgacgcagaatcctcatgaagtggct
cgtgtaagaaacatcaaccgtgttataatgggaagatttcaaatcgagccgtggtatttt
tcgccgtacccgattgagctcacagacgaggacgtcgtttacatcgatgattttactttg
caatattttggatccagaaagcagtatgaacgctatagaaaaaaatgtacactgcgacat
cctccggggaacgaaatttatagagatgattatgtgtcatttttcgagatcgacggcagg
caacagaggacatggtgccgaaacttatgtttactttcaaaactttttcttgaccataag
acgttgtactacgatgtggatccgttcttattttattgcatgaccagaagagatgaactg
gggcatcatttagttggatatttttctaaggagaaagaatctgcggacggctataatgtt
gcctgtatcttaactttgccacagtatcaacgaatggggtacgggagacttttgattgaa
ttctcatacgaactctccaaacaagaaggcaaagttggctctcctgagaagccgctctcg
gacttaggtttattatcatacagagcgtattgggctgatacgctcatcaccatacttgct
gatcatgggcgtgagattacaatcgacgagattagctcaatgacatccatgacgacaact
gatatcctgcatacagccaagaccttgaatatcttgagatattacaaggggcagcatata
atcttcctcaatgatgacataatgaagaggtatgaccagctgttttcaaaaccaagaagg
agaattacaccctcgaaacttgtttggaagccgcctatcttcacagcttcacagttgcgg
tttgcatggtaa

DBGET integrated database retrieval system