KEGG   Torulaspora delbrueckii: TDEL_0B01360Help
Entry
TDEL_0B01360      CDS       T02236                                 

Gene name
TDEL0B01360
Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TDEL_0B01360 (TDEL0B01360)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TDEL_0B01360 (TDEL0B01360)
Exosome [BR:tdl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TDEL_0B01360 (TDEL0B01360)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:240795..242435
Genome map
AA seq 546 aa AA seqDB search
MALSKKPEGFLSRNGKPKLRILLSALLVVVALVNVFSEQLAVSFNFESFWSFRKAPKKNV
IFFVTDGMGPASLSLSRSFRQYTQDLPIDDVLTLDDHFIGSSRTRSSDSLITDSAAGATA
FSCGLKSYNGAIGVDSDKNPCGTLLEGAKLQGYLTGLVVTTRITDATPAAFSAHADYRFQ
EDLIALHQLGEYPLGRSVDLMLGGGRTNFYPPDADSKYGSHGSRADGRNLIKEAQEDGWQ
YAGSREEFDQLQNGHNVSLPLLGLFADNDIPFDIDRKDDEYPSLEEEAMTAINALTKATE
DSDKGFFLMIEGSRIDHAGHQNDPAAQAREVLAFDRAFKAVIEYVENSDTETIIISTSDH
ETGGLTIGRQVTPQYPEYIWFPRILEQANHSGEYLTSKFLAFKDSASKKDERSFVKEELF
EKGLSIKDYTEDDVDAIISAPDSGRIKDKLNDMVSFRAEIGWTTHGHSAVDVNIYAYANK
ESTWKTLLHKLQGNHENTEIGQFMADFLEIDFAEVTEKVRDTKHSPKAADVSAQSDLHDE
YYHKLN
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcactttccaagaagccagagggctttttgagccgcaacggaaagcctaagctaaga
attttactgtctgccctgctagttgtggtcgctctggttaatgtgttttctgaacaactg
gctgtaagcttcaatttcgagtcattctggtctttcagaaaggcaccgaaaaagaatgtg
atattttttgttactgatgggatgggtccagcttcgttatcattgagtagatcttttagg
cagtacacgcaagacctgcccattgacgacgttttgaccctagatgaccatttcataggt
tcctcccgtacaaggtcttctgactctctaatcaccgactctgcagctggtgccactgct
ttctcctgtggtttaaaatcatacaacggtgcgattggtgtcgactcagataagaaccca
tgtggtacactgttggagggggccaaactgcaaggttatttaactggtctagtggttacg
actaggattacggatgctacaccggcagcattcagtgctcatgcggactaccgtttccag
gaagatcttatcgccttacatcaactaggtgaatatccattgggtcgctcagtagactta
atgctaggtggtggtcgtaccaatttttacccccctgatgcagactccaagtacggttcc
catggctctcgtgcggatggaagaaacctgatcaaggaagcacaagaagacggctggcaa
tacgctggttctcgtgaagaattcgaccagttacaaaatggccacaatgtctcattacca
cttctaggtcttttcgcagataatgacatcccatttgatattgacagaaaggatgacgaa
tatccatctttggaagaagaagccatgaccgctatcaacgcattgactaaagcaactgag
gattcggataaaggtttcttcttgatgattgaaggatcaagaattgatcatgcaggtcac
caaaacgatccagcggctcaggcaagagaagtgctggcttttgatcgagcttttaaggct
gtcattgaatatgttgaaaactctgacactgaaacaattattatttcaacttctgatcat
gaaaccggaggattgactatcggaagacaggtcactcctcaatatcctgaatacatctgg
ttcccaaggatcttggaacaggcgaaccactctggtgagtacttaaccagtaaatttttg
gcattcaaggacagcgcaagtaagaaagatgagcgttcatttgtgaaggaagagctcttc
gaaaaaggtttgtccatcaaggattatactgaagacgatgttgacgccatcatctcggcg
ccagactccggaagaatcaaggataagttaaacgatatggtctctttcagagcagaaatt
ggctggaccacacatggtcatagcgccgttgatgtcaacatttatgcttacgcgaacaag
gagagcacttggaagactttgttgcataaattgcaaggtaatcatgaaaacacagagatt
ggccagttcatggctgatttccttgagattgattttgctgaggtcactgagaaagttcgc
gacactaaacattcgcctaaagcagccgatgttagtgcacaatctgatctacacgacgag
tactatcataaattgaactaa

DBGET integrated database retrieval system