KEGG   Torulaspora delbrueckii: TDEL_0B01980Help
Entry
TDEL_0B01980      CDS       T02236                                 

Gene name
TDEL0B01980
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:352747..353148
Genome map
AA seq 133 aa AA seqDB search
MSAKAEKKPASKAPAEKKPAAKKTASSTDSNKKRSKVRKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSAASQA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaagctgaaaagaaacctgcttccaaagccccagctgagaaaaaaccagct
gctaagaagactgcttcctccacggacagtaacaagaagagaagtaaggtcagaaaggaa
acttattcttcttacatctacaaagttttgaaacaaactcacccagataccggtatctct
caaaaatcaatgtccattttgaattctttcgtcaacgatattttcgagagaattgccact
gaagcttctaaattggctgcctacaacaagaaatctactatctctgccagagaaattcaa
actgcagttaggttgatcctaccaggtgaattggcaaagcatgcagtctccgaaggtact
agagctgtgaccaagtactcctctgctgctagtcaagcttaa

DBGET integrated database retrieval system