KEGG   Torulaspora delbrueckii: TDEL_0B03060Help
Entry
TDEL_0B03060      CDS       T02236                                 

Gene name
TDEL0B03060
Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TDEL_0B03060 (TDEL0B03060)
Peptidases [BR:tdl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TDEL_0B03060 (TDEL0B03060)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:545366..547570
Genome map
AA seq 734 aa AA seqDB search
MPKVIYFLTDSGSNVNSQWLHRFSSSNSRILRQLSYGALVALSLYVLTPTITKLIFGSKM
FSSSSKRVDKYTTGLINNRNDCFANCSVQALASLPGLTSYLNEFLHQVSDAVVLINDDTD
DKQASRGTQYLDHGILTPKLEVDSNPIDNHQSLDGLVSSAVQKSKSSTSVSTLQDEPTHG
DHTPALSTAQHSLNEEEENSEETDDETTEPKIPRILMHQSLASMLSQLQETITSSRHISV
WPLLRVLEIIFNAKISTGQNDAHELTQVILETLQKENMKLRKFVKNNDINVSIPELPFGG
QLADHLVCMKCTNSSKVNIHPFIIYPLTVPQAMSAKLSDMVSDNQTDTIEGYSCLTCKVS
TIVNYEKGRGYAKCTQEEKRILKTLEDALPDMAINDELSDELTSYINSYNKDGIVGADLK
STIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGINP
ISYKLKAIVAHSGSHSQGHYECYRHKPDFVKDTTTKTVINRSPTIDKSLITPEQSKEPNG
TQKQADPQDYIGDGNFTLNAAALPTRSNSSNSSIHNSEEDYVISGSEGSKPSRKPSTIKK
ITGFLSRKGTMSGEEPPLDIKSPASIARSRAGSIATSDYGRSRAGSISSTQMGRTTSIDS
QSSHLTSSESNVGTTSASDADAVLGDQRILKKIKSVSKYPYWRISDAEVKEAKVDQVLGE
MRYVYMLYYELLTS
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagtgatttatttcctaacagattcgggatctaacgtcaatagccagtggctg
catcggttttcgagtagtaatagtagaattctccgtcaattgtcatacggagcactggtg
gcactttcgctttacgtgctaaccccaactatcactaagcttatatttggatcaaaaatg
ttttccagtagttctaagagagttgataaatatactacggggcttatcaacaaccggaac
gactgttttgccaattgttcggtgcaagcgttagcttctttgccgggactgacctcgtac
ttgaacgagtttctgcatcaggtttctgatgctgtagttttgattaatgacgatacagat
gataagcaggcttctcgtggtactcaatatttggatcatgggatacttactcctaaactt
gaggtggactccaatcctatagacaatcatcagagtttggacgggttagtctcttctgcg
gttcaaaagagcaaatcttctacttcagttagtactttgcaagatgaacctactcacggc
gatcatactcctgctttgtccactgcccaacattcgttgaatgaggaggaagaaaatagt
gaggaaacagatgatgagacgactgaacctaagattccaagaatcctgatgcatcagagt
ctagctagtatgctttcgcaacttcaagaaactattacatcgtctagacatatctctgtg
tggcctctacttcgtgtcctcgagataatattcaatgcgaagatctccacgggccaaaat
gatgctcatgagctgactcaagtcattctggagaccttgcaaaaggagaatatgaaattg
agaaagtttgtgaagaataatgatataaatgtcagcattcccgagttgcccttcggtggt
caactagcagaccatctggtatgcatgaaatgtacaaattcttccaaagttaatatccat
ccgttcatcatctacccacttactgttcctcaggctatgtcagccaagctatctgacatg
gtgtcggacaaccaaacggataccatagagggctactcatgcctcacatgtaaggtctcg
acaatagttaactatgaaaagggtcgtggttacgcgaaatgtacacaagaagagaaaagg
attctgaagactttggaagatgcattaccggatatggccattaatgatgaactctcagat
gagctaacttcatacattaattcctacaacaaggatggtattgtcggtgcagatttgaaa
tccacgattgttaagaagactgttgtcgtggaatctccaaagacgttggtcatgcattta
tcccgttcgatgttcgatggtatttcctatcaaaggaactcgtgtggtgtggcatttgac
gaaatcctagaatctcgagagcaagtgattcgtcataacaaatgtgtgggaattaacccc
atctcctataaacttaaagccatagtggcacattccgggtcacattctcaaggtcactac
gaatgttacagacacaagcctgattttgttaaggataccacaaccaagacagtgattaac
aggtcgcccacaattgacaaatctttgatcacgccagaacaatcaaaggagcctaacgga
actcagaaacaggcagatccacaagactatatcggggatggcaatttcacgctgaacgca
gctgctttgccaacgagatcgaacagtagtaatagcagtattcacaactccgaggaggac
tacgttattagcggctcagaaggctccaaacctagcagaaagccatcgacgatcaaaaag
atcacaggcttcctatcgagaaagggcacgatgagcggagaagagcccccattggatatc
aagagtccagcgagcatagcgcgcagtcgggcaggcagtatcgctaccagcgattacggc
agaagcagagctgggagcatctcgtccacgcaaatgggaagaaccacatctattgactcc
caatcctcacatctcacctcctctgaatcgaatgttgggacgactagtgcgagtgatgca
gatgcagttctcggtgaccagcgcatcctcaagaagatcaagagtgtctcgaaatatcca
tactggcgtatatcggacgcagaagtgaaagaggccaaggttgaccaggttctcggcgag
atgagatatgtctacatgctctactatgagcttttgacaagttga

DBGET integrated database retrieval system