KEGG   Torulaspora delbrueckii: TDEL_0B03590Help
Entry
TDEL_0B03590      CDS       T02236                                 

Gene name
TDEL0B03590
Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TDEL_0B03590 (TDEL0B03590)
Enzymes [BR:tdl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TDEL_0B03590 (TDEL0B03590)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:648491..649429
Genome map
AA seq 312 aa AA seqDB search
MWITGWAVWLLVGLQSTAWCQNFYDSDPHMMELTPKSFDKVIHDTNYTTILEFYAPWCGY
CQQLKGIMKKAAKAMNGVVQVASVNCDLAKNKKLCAEHKVQGFPTIMVFRPPKVDSSKTG
AVRIPARKHAHEVYKGVRKLSPMIDFALSRMKNYVKRLNGLSKLSSILTKSPKRTLILLS
KKDKVSPIYKSVALDWLDTFDCYTVPNSKLRVLEDGDELAKTHPRIFQFLHDIIPDQIKS
EESILIALDGANDQYKVIDGGSFAKTEISRILNENFDILPREGPLSKREKYLHFIKTGKK
GDSWKPKLHDEL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtggattactggatgggcagtttggttactggttgggttgcaaagcacggcttggtgc
cagaacttttacgattctgatccgcatatgatggagctcacaccaaagagttttgacaaa
gtcattcacgatacaaattacacaacaatccttgaattttatgcaccatggtgtggttat
tgccagcagttgaagggaattatgaagaaagcagcaaaggcgatgaatggagtggttcag
gtggcctctgttaactgcgatctggcaaaaaataagaaattgtgtgcagagcataaagta
caaggtttcccgacaattatggtttttagacctcctaaagtggatagtagcaagactgga
gctgtaaggattccggcaagaaaacatgcacacgaggtatacaaaggtgtaaggaaactg
agcccaatgattgatttcgctctctctagaatgaaaaactacgtcaagagattgaatggg
ttgagtaaattgagctctatcctgacaaaatcaccaaaaaggacattgattttactatcg
aagaaggataaagtttcaccaatttataaatcagtggccctcgattggcttgatactttt
gattgctacacggttccaaactctaagcttcgcgtcctcgaagatggtgatgagcttgcc
aagacgcatcccaggatctttcagtttttgcacgacattatcccagatcaaataaagagc
gaagaaagtatcttgattgctcttgacggtgcgaatgatcaatacaaagtcattgatggt
gggtcttttgcgaagacagaaatctcaagaatacttaacgagaacttcgatatcttgccc
agagaaggtccattaagtaaaagagaaaagtacttgcacttcataaaaacgggcaaaaag
ggtgattcgtggaagccaaagcttcacgacgaattgtaa

DBGET integrated database retrieval system