KEGG   Torulaspora delbrueckii: TDEL_0B03670Help
Entry
TDEL_0B03670      CDS       T02236                                 

Gene name
TDEL0B03670
Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TDEL_0B03670 (TDEL0B03670)
Peptidases [BR:tdl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TDEL_0B03670 (TDEL0B03670)
Transcription machinery [BR:tdl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TDEL_0B03670 (TDEL0B03670)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(656511..657902)
Genome map
AA seq 463 aa AA seqDB search
MTGCQHIEQVFQNEKSKEGVLKTCNAARYMINHFTPKDKYMHAMRCSECHEINSGSNFMC
LQCGFCGCWNGEHFLMHSKKVGHVFGINSSNGLLFCFKCSDYIGNNELIIASMLNKYWDD
VSIKTVVPSVERRDGLHGLLNLGSTCFMSSILQILIRNPYFFNFSISQSHSKKCPIQDPK
SCISCALEKMVCEFYGSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAGYSQQDAHEFW
QFLLNQLHHDFQVCSGKGVNDAISDDLCTCIAHSTFQGLLKSSIVCPDCQNDSKTTIDPF
MDLSLDIKDKSNLYNCLDSFHKKERLHDFNYHCPNCNTSQDAIKRLSIYKLPSVLVLQLK
RFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDLIYELIGVVAHKGTVNEGHY
VATTKVAGRQWFKFNDSMVSSVTQEEALNEQAYLLFYSVLQVN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgactggatgtcaacatattgagcaggttttccaaaatgagaagtccaaggagggtgtg
ttaaagacatgtaatgcggcacgctatatgatcaaccatttcaccccgaaagataagtat
atgcatgctatgcgatgctctgagtgtcatgagatcaattccggatccaattttatgtgc
ttgcagtgcggattctgtggttgttggaacggagagcatttcttgatgcatagcaagaaa
gtagggcatgttttcggaatcaattcgagtaatggattgctcttttgtttcaaatgcagt
gactatattggaaacaatgaacttataattgcttcgatgcttaacaaatactgggatgac
gtttcaatcaagacagtggtaccgagcgtggagcggagggatggtttgcatggattgctg
aatctgggatctacttgttttatgagcagtatacttcagattctcattcgcaatccatac
ttcttcaacttctccattagtcaatcgcattccaagaaatgtccgattcaggatcccaag
agttgcatatcatgtgcattggaaaagatggtttgcgagttttatggttcttcggcatat
agcaccggagatgttgaaccacaagccatgtattctggttttattggcctgttagtatgc
tcatggaaaatcaatgaaaacttggccggatactcacaacaggatgcacacgaattttgg
caatttttactgaatcaactgcaccatgattttcaagtttgcagtggcaaaggagtcaac
gacgccatttctgatgatctttgcacttgtattgcacattctacctttcaaggtttacta
aagagttctatcgtttgccccgattgccaaaatgactctaaaaccaccattgatcctttc
atggatctatcgctcgacataaaagacaaatcgaatctttataactgtctggacagtttc
cataaaaaagagcggttgcatgattttaattaccattgcccaaattgcaatacatcccaa
gacgctataaagcgtttaagcatatacaaacttccatccgtgctggtgctccaattgaaa
cggtttgaacatcttcttaatgggaatagtttgaaattgaatgatttcattgagtaccca
ccttacctgaatatgcgggactactgtagttcaggtgactcagacgtcgatgtcccggat
ttgatttatgaactgataggtgtcgttgctcataagggcacggtcaatgaaggacattac
gttgcaacaacgaaagtagccggtagacagtggtttaaatttaatgattccatggtttct
tctgtcactcaggaagaagccttgaacgaacaagcctatttactcttctactccgtatta
caagtgaactaa

DBGET integrated database retrieval system