KEGG   Torulaspora delbrueckii: TDEL_0B03750Help
Entry
TDEL_0B03750      CDS       T02236                                 

Gene name
TDEL0B03750
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tdl  Torulaspora delbrueckii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tdl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(673137..673922)
Genome map
AA seq 261 aa AA seqDB search
MKMKVLLLKNKTAQLDKYEIAFEDNGFEPFFIPLIKHTHVPEEIMDLVHDKAYLENLSNI
IVTSQRTVECLSESVLPNLTPSLREALLNKTVYAVGPATRDFLLRVGFKTVKGGDDAGTG
SILADIIYNDLLAEDDRIDNHRELLLLVGEIRRDIIPVKLSNKGLKVREVVTYKTVDLND
NADRFKDAASPNSWMVLFSPQGTGEILELWKNKLAEDIKIASIGPTTEKYLNENGIQPHV
VSAKPDADHLLNAIREYSCKN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaagtccttctactcaaaaacaagactgctcagctagataaatatgagatt
gcattcgaagacaatgggtttgaaccattcttcatcccgctgatcaaacatacccatgtc
ccggaggagataatggatttggtgcacgataaagcttacctcgagaacttaagcaacatc
attgtcacttcacagaggacggttgagtgcttgagtgaatccgttttacctaatcttaca
ccatcgcttcgagaagccttactaaataagactgtctacgctgtcggtccagcaacgaga
gactttttgctaagagttggtttcaagactgtcaaaggtggtgatgatgcaggaactggt
agtatattagctgatataatatacaatgacttgttagctgaggacgacagaatcgacaat
caccgtgaactattgctgctcgttggtgagattcgaagagatatcatcccagtaaaactg
tccaataagggtctcaaagtgagagaggtcgtcacttacaagacggtagatctcaatgat
aatgctgatagatttaaagatgctgcttcacctaacagttggatggtactatttagtcct
caaggaacaggtgaaattttggaactttggaagaacaaactggcggaagatattaagatt
gccagcattgggcctactactgaaaaatatctgaatgagaacggaatccagccgcatgtg
gttagtgccaaaccagatgccgaccaccttttgaacgccatacgtgaatactcctgcaaa
aattaa

DBGET integrated database retrieval system