KEGG   Torulaspora delbrueckii: TDEL_0B03750Help
Entry
TDEL_0B03750      CDS       T02236                                 

Gene name
TDEL0B03750
Definition
(RefSeq) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00860  Porphyrin and chlorophyll metabolism
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TDEL_0B03750 (TDEL0B03750)
Enzymes [BR:tdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TDEL_0B03750 (TDEL0B03750)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Ish1
Motif
Other DBs
NCBI-GeneID: 11504583
NCBI-ProteinID: XP_003679715
UniProt: G8ZPG0
Position
2:complement(673137..673922)
Genome map
AA seq 261 aa AA seqDB search
MKMKVLLLKNKTAQLDKYEIAFEDNGFEPFFIPLIKHTHVPEEIMDLVHDKAYLENLSNI
IVTSQRTVECLSESVLPNLTPSLREALLNKTVYAVGPATRDFLLRVGFKTVKGGDDAGTG
SILADIIYNDLLAEDDRIDNHRELLLLVGEIRRDIIPVKLSNKGLKVREVVTYKTVDLND
NADRFKDAASPNSWMVLFSPQGTGEILELWKNKLAEDIKIASIGPTTEKYLNENGIQPHV
VSAKPDADHLLNAIREYSCKN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaagtccttctactcaaaaacaagactgctcagctagataaatatgagatt
gcattcgaagacaatgggtttgaaccattcttcatcccgctgatcaaacatacccatgtc
ccggaggagataatggatttggtgcacgataaagcttacctcgagaacttaagcaacatc
attgtcacttcacagaggacggttgagtgcttgagtgaatccgttttacctaatcttaca
ccatcgcttcgagaagccttactaaataagactgtctacgctgtcggtccagcaacgaga
gactttttgctaagagttggtttcaagactgtcaaaggtggtgatgatgcaggaactggt
agtatattagctgatataatatacaatgacttgttagctgaggacgacagaatcgacaat
caccgtgaactattgctgctcgttggtgagattcgaagagatatcatcccagtaaaactg
tccaataagggtctcaaagtgagagaggtcgtcacttacaagacggtagatctcaatgat
aatgctgatagatttaaagatgctgcttcacctaacagttggatggtactatttagtcct
caaggaacaggtgaaattttggaactttggaagaacaaactggcggaagatattaagatt
gccagcattgggcctactactgaaaaatatctgaatgagaacggaatccagccgcatgtg
gttagtgccaaaccagatgccgaccaccttttgaacgccatacgtgaatactcctgcaaa
aattaa

DBGET integrated database retrieval system