KEGG   Torulaspora delbrueckii: TDEL_0B04220Help
Entry
TDEL_0B04220      CDS       T02236                                 

Gene name
TDEL0B04220
Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tdl  Torulaspora delbrueckii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TDEL_0B04220 (TDEL0B04220)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TDEL_0B04220 (TDEL0B04220)
Peptidases [BR:tdl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TDEL_0B04220 (TDEL0B04220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:747864..750341
Genome map
AA seq 825 aa AA seqDB search
MTETKSESTMTVRSKHCKTLARLSRIAEQFLDQDETSGKRKDDEMMALLQRCLDILETYR
DECKKLKTREGRLSQDELYETYESAYVYYKIVHNTVLNKVPNLKQFQVVKKQTNTNDRQL
MEIYNMLVKSLLNDEKIGQIKAFLKENSKPDVEMVLNTGSTISSSHLQQLIDSHNDSTLL
IDLRQRGEFSKLHINAKNVICIEPISFKAQYTDLEIEKKSLITSPKEEIGLFRARDTFKF
IVLYTSEDKESHSRSFDLQQQAILLDLLINHSFAKPLNANTRVYVLKAGFSNWVSEGRQC
IGEEHHGTYTNGATFPELTFSIGGSLKVRQDIQEQPPLLSNGAYLSASSASSSPHLSPSN
HYSRLNRSTQYPQTPQLTAGSNGAHYPGPLLPIDNAVSPMANHIPKLRAPRVFTADNEAI
VPVKMNDLSKPPSQAIPPLPKFPSRESSPALGSANKYDLDFAVGLENMGNSCYINCIVQC
LLGTHELTNIFLNKSYERHINMNSRLGSKGVLAKYFAKLTHSMYQNASHKLNEKGKPVQP
MEFKMACGTINSLFRESGQQDCQEFCQFLLDGLHEDLNQCGGNPPLKELSDEAEKMREKL
SLRIASSIEWERFLTTDFSVIVDLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVPHAKS
CNIIDCFKEFTKVEKLETDEQWSCPRCKKKQPSTKKLTITRLPRNLIIHLKRFDNMMNKN
NVFVKYPFTLDLTPYWANDFDGRLPPGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHY
TSYVDKGPKRGWCYFDDTSFRPVRNATECITPNAYVLFYHRVYQV
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacgaaatcggaatctactatgacagtgcgttcgaagcactgcaagacgttg
gctaggttgtctcgaatagcggaacagtttcttgatcaggatgagactagtggcaagcga
aaggatgatgaaatgatggccctcttgcaaagatgtttagatattttggaaacatatcga
gatgaatgtaaaaagttgaagactagggaaggacgactatcacaggatgaactatatgaa
acctacgagtcagcttacgtctactacaagatcgtccacaatactgtgcttaataaagtg
ccgaatttgaaacagttccaagtggtaaagaagcaaacgaataccaatgataggcaactc
atggagatttataatatgttggtcaaaagtctattgaatgatgaaaagatcggtcaaatt
aaagctttcttgaaggaaaattctaaaccagatgtggagatggttttgaatacagggagt
accatttcatcctctcatttacaacaacttattgatagtcataacgattccacattattg
attgatctgcgacagaggggagagttctctaaattgcatattaatgcgaagaatgtcatt
tgcattgaacccatctcattcaaggcccaatacacagatcttgagattgagaagaaatcc
ttgattacttcaccaaaggaagagatcggtttattccgggcaagagatacgttcaaattt
atcgtgctatacactagcgaggataaagaaagtcatagtaggagttttgatttacagcag
caagcgattctattggatctgttaataaatcattcttttgcgaaaccactaaatgccaac
acgagagtctacgttctgaaagctggtttttcgaattgggtctcggagggaagacaatgt
atcggcgaagaacaccatggtacttatacaaatggtgctacttttcccgaattaactttc
tctataggtgggtctttgaaagttcgacaggacattcaggaacagcctcctttactttcg
aatggggcttacctttcggcgtcatcagccagctcgtcgccacacttatcaccgtcgaat
cactattcaagattgaatagatctacacaatatccacaaacaccacaactaacagctggc
agtaatggcgctcactatcccgggccgctattgccaatagataacgcagtatccccgatg
gcaaatcacattcccaaacttagagcaccaagagttttcacagcagataatgaagccatt
gttcctgtcaaaatgaatgacctttcgaaaccaccaagtcaggctatacctccattacca
aaatttccttcccgtgaaagttcaccagcattaggtagcgctaacaaatatgatctagat
tttgctgtcggattggaaaatatggggaactcatgctatattaattgcatagttcagtgc
ttattgggtacacatgaattgaccaacatttttcttaataaatcatatgaaaggcatatc
aatatgaacagcaggctgggatccaagggagtcctagcaaagtatttcgcaaaactcacg
cattcgatgtatcaaaatgcatcccacaagttgaatgaaaaaggtaaaccggttcaaccc
atggaattcaaaatggcatgcggtacaatcaactcactcttccgtgaatctggacagcaa
gattgtcaggagttttgccagtttttactggatggactgcatgaagacttgaaccaatgt
ggtggtaatccacctttaaaggaactgtctgatgaagcagaaaagatgagggaaaaatta
tcattgagaattgcatcttccattgagtgggagaggttcttgacgacagatttcagcgtt
attgtcgatcttttccaaggccaatacgcctcacaactaaggtgccaagtatgtggtctc
acaagtacgacataccaaccattttcagtcctatcagtacccgttcctcatgcaaaatcc
tgcaacataatagactgtttcaaagagtttactaaagttgaaaagcttgaaacagacgag
caatggtcctgtccaagatgtaagaagaagcaaccttctacaaaaaaactaactattaca
cgtttgcccaggaacctgatcattcacttgaaaagatttgataacatgatgaacaaaaac
aacgtattcgtgaagtatccatttacactggatttgacaccctactgggcaaatgatttt
gatgggagattaccgccaggtgttactgaggagttgcctaccagaggacaaagtccgcca
ttcaattataagctttatggaatagcatctcatgttgggagtttgtatggagggcattac
acttcatatgtcgacaagggcccgaaaagaggctggtgctatttcgatgatacaagcttc
cgccctgttagaaacgccactgaatgtatcactcctaatgcttacgtgttgttctaccat
agagtgtaccaggtttag

DBGET integrated database retrieval system