KEGG   Torulaspora delbrueckii: TDEL_0B04490Help
Entry
TDEL_0B04490      CDS       T02236                                 

Gene name
TDEL0B04490
Definition
(RefSeq) hypothetical protein
Organism
tdl  Torulaspora delbrueckii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2:792559..793629
Genome map
AA seq 356 aa AA seqDB search
MGKRVLLFNISSEFQLKSLLGEGAYGVVCSAVHKPTGELVAIKKIEPFDKPLFALRTLRE
IKLLKHFHHENIVSIFDIQRPDSFENFNEVYIIQELMQTDLHRVIATQQLTDDHIQYFLY
QTLRALKTLHGSNVIHRDLKPSNLLINANCDLKVCDFGLARIAEPGNDLSQDSNPQCGLT
EYVATRWYRAPEVMLTAAQYSAAMDVWSCGCILAELFLKRPLFPGRDYRHQLTLIFGVLG
TPRGRDLRAVPSRRAREYIATLPRSEGIVPLARVFPPGTSPEGIDLLRRMLRFDPRGRIT
AEQALAHPYLRTYHDPRDEPSGEAISPGFFTFDRQKDVLTTKDLKRMLWDEIFISS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagagtgctacttttcaatatctctagtgaatttcaactaaaatcccttcta
ggcgaaggagcttatggagtagtgtgttccgccgtgcacaagcccacaggcgaactagtc
gctataaagaaaatcgagcccttcgacaaaccattatttgcactacgtactttacgcgag
atcaaactactgaaacatttccatcatgaaaatatagtctccatattcgatatccaaaga
ccagattcctttgaaaatttcaatgaagtctatatcatacaagaattaatgcaaacagat
ttgcaccgagtaatcgctacacaacaacttacagacgatcatatccaatatttcctatac
caaactttaagagcactaaaaacgcttcacggttctaacgtgatccatcgagatctaaag
ccttccaacttgttaatcaacgctaattgcgacctcaaggtctgcgatttcggtctagca
cgaatcgccgaaccaggaaacgacctctcccaggattcgaacccgcaatgcggacttacc
gaatacgttgccacccgctggtacagagcgccggaagttatgttaacagccgcgcagtac
tcggcggctatggacgtgtggtcgtgtggctgtatactagccgagctattcttaaagaga
ccgctgttcccggggcgcgattaccgacaccaactaacgctgatttttggcgtattggga
acgccccggggacgcgacctccgggctgttccttcaagacgcgctcgtgagtacatcgct
actttgccccggagcgaaggaatcgtccccttggcgcgcgttttccctccggggaccagc
cctgagggcatcgatttattgcgcaggatgctcaggttcgatcctcgtgggcggattaca
gctgagcaagcacttgcacatccatacttgcgaacttatcacgatcctcgtgatgagccc
tcaggcgaggctatttcccccggtttcttcacttttgaccgtcaaaaagatgtgctgacc
accaaggatcttaaacgtatgttgtgggatgaaatctttatttcatcgtag

DBGET integrated database retrieval system