KEGG   Torulaspora delbrueckii: TDEL_0B04490Help
Entry
TDEL_0B04490      CDS       T02236                                 

Gene name
TDEL0B04490
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TDEL_0B04490 (TDEL0B04490)
Protein kinases [BR:tdl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   TDEL_0B04490 (TDEL0B04490)
Exosome [BR:tdl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TDEL_0B04490 (TDEL0B04490)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:792559..793629
Genome map
AA seq 356 aa AA seqDB search
MGKRVLLFNISSEFQLKSLLGEGAYGVVCSAVHKPTGELVAIKKIEPFDKPLFALRTLRE
IKLLKHFHHENIVSIFDIQRPDSFENFNEVYIIQELMQTDLHRVIATQQLTDDHIQYFLY
QTLRALKTLHGSNVIHRDLKPSNLLINANCDLKVCDFGLARIAEPGNDLSQDSNPQCGLT
EYVATRWYRAPEVMLTAAQYSAAMDVWSCGCILAELFLKRPLFPGRDYRHQLTLIFGVLG
TPRGRDLRAVPSRRAREYIATLPRSEGIVPLARVFPPGTSPEGIDLLRRMLRFDPRGRIT
AEQALAHPYLRTYHDPRDEPSGEAISPGFFTFDRQKDVLTTKDLKRMLWDEIFISS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagagtgctacttttcaatatctctagtgaatttcaactaaaatcccttcta
ggcgaaggagcttatggagtagtgtgttccgccgtgcacaagcccacaggcgaactagtc
gctataaagaaaatcgagcccttcgacaaaccattatttgcactacgtactttacgcgag
atcaaactactgaaacatttccatcatgaaaatatagtctccatattcgatatccaaaga
ccagattcctttgaaaatttcaatgaagtctatatcatacaagaattaatgcaaacagat
ttgcaccgagtaatcgctacacaacaacttacagacgatcatatccaatatttcctatac
caaactttaagagcactaaaaacgcttcacggttctaacgtgatccatcgagatctaaag
ccttccaacttgttaatcaacgctaattgcgacctcaaggtctgcgatttcggtctagca
cgaatcgccgaaccaggaaacgacctctcccaggattcgaacccgcaatgcggacttacc
gaatacgttgccacccgctggtacagagcgccggaagttatgttaacagccgcgcagtac
tcggcggctatggacgtgtggtcgtgtggctgtatactagccgagctattcttaaagaga
ccgctgttcccggggcgcgattaccgacaccaactaacgctgatttttggcgtattggga
acgccccggggacgcgacctccgggctgttccttcaagacgcgctcgtgagtacatcgct
actttgccccggagcgaaggaatcgtccccttggcgcgcgttttccctccggggaccagc
cctgagggcatcgatttattgcgcaggatgctcaggttcgatcctcgtgggcggattaca
gctgagcaagcacttgcacatccatacttgcgaacttatcacgatcctcgtgatgagccc
tcaggcgaggctatttcccccggtttcttcacttttgaccgtcaaaaagatgtgctgacc
accaaggatcttaaacgtatgttgtgggatgaaatctttatttcatcgtag

DBGET integrated database retrieval system